KEGG   Rattus norvegicus (rat): 25419
Entry
25419             CDS       T01003                                 

Gene name
Crp, Aa1249, Ab1-341, Ab2-196, Ac1-114, Ac1262, Ac2-069, Ba2-693
Definition
(RefSeq) C-reactive protein
  KO
K16143  C-reactive protein
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    25419 (Crp)
SSDB
Motif
Pfam: Pentaxin Laminin_G_3
Other DBs
NCBI-GeneID: 25419
NCBI-ProteinID: NP_058792
RGD: 2411
Ensembl: ENSRNOG00000000053
UniProt: P48199 H6X2W5
Position
13q24
AA seq 230 aa
MEKLLWCLLITISFSQAFGHEDMSKQAFVFPGVSATAYVSLEAESKKPLEAFTVCLYAHA
DVSRSFSIFSYATKTSFNEILLFWTRGQGFSIAVGGPEILFSASEIPEVPTHICATWESA
TGIVELWLDGKPRVRKSLQKGYIVGTNASIILGQEQDSYGGGFDANQSLVGDIGDVNMWD
FVLSPEQINAVYVGRVFSPNVLNWRALKYETHGDVFIKPQLWPLTDCCES
NT seq 693 nt   +upstreamnt  +downstreamnt
atggagaagctactatggtgtcttctgatcacgataagcttctctcaggcttttggtcat
gaagacatgtctaaacaggccttcgtatttcccggagtgtcagctactgcctatgtgtcc
ctggaagcagagtcaaagaagccactggaagccttcactgtgtgtctctatgcccacgct
gatgtgagccgaagcttcagcatcttctcttacgctaccaagacgagctttaacgagatt
cttctgttttggactaggggtcaagggtttagtattgcagtaggtgggcctgaaatactg
ttcagtgcttcagaaattcctgaggtaccaacacacatctgtgccacctgggagtctgct
acaggaattgtagagctttggcttgacgggaaacccagggtgcggaaaagtctgcagaag
ggctacattgtggggacaaatgcaagcatcatcttggggcaggagcaggactcgtatggc
ggtggctttgacgcgaatcagtctttggtgggagacattggagatgtgaacatgtgggac
tttgtgctatctccagaacagatcaatgcagtctatgttggtagggtattcagccccaat
gttttgaactggcgggcactgaagtatgaaacacacggtgatgtgtttatcaagccgcag
ctgtggcccttgactgactgttgtgagtcctga

DBGET integrated database retrieval system