KEGG   Rattus norvegicus (rat): 25420Help
Entry
25420             CDS       T01003                                 

Gene name
Cryab, AACRYA
Definition
(RefSeq) crystallin, alpha B
  KO
K09542  crystallin, alpha B
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04141  Protein processing in endoplasmic reticulum
rno04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    25420 (Cryab)
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    25420 (Cryab)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:rno03110]
    25420 (Cryab)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    25420 (Cryab)
Chaperones and folding catalysts [BR:rno03110]
 Heat shock proteins
  HSP20
   25420 (Cryab)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   25420 (Cryab)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Crystallin HSP20 ArsA_HSP20
Motif
Other DBs
NCBI-GeneID: 25420
NCBI-ProteinID: NP_037067
RGD: 2414
Ensembl: ENSRNOG00000010524
UniProt: P23928
Position
8q23
AA seq 175 aa AA seqDB search
MDIAIHHPWIRRPFFPFHSPSRLFDQFFGEHLLESDLFSTATSLSPFYLRPPSFLRAPSW
IDTGLSEMRMEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHR
KYRIPADVDPLTITSSLSSDGVLTVNGPRKQASGPERTIPITREEKPAVTAAPKK
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atggacatagccatccaccacccctggatccggcgtcccttctttcctttccactcccca
agccgcctctttgaccagttcttcggagagcacctgttggagtctgacctcttctctaca
gccacttccctgagccccttctaccttcggccaccctccttcctgcgggcacctagctgg
attgacactgggctctcagagatgcgtatggagaaggacaggttctctgtgaacctggac
gtgaagcacttctctccagaggaactcaaagtcaaggttctgggagacgtgattgaggtg
cacggcaagcacgaagagcgccaggacgaacatggcttcatctccagggagttccacagg
aagtaccggatcccagccgacgtggatcctctcaccattacttcttccctgtcatcggat
ggagtcctcactgtgaatggaccaaggaaacaggcctctggccctgagcgcaccattccc
atcacccgtgaagagaagcctgctgtcactgcagcccctaagaagtag

DBGET integrated database retrieval system