KEGG   Rattus norvegicus (rat): 25423
Entry
25423             CDS       T01003                                 

Symbol
Ctsc
Name
(RefSeq) dipeptidyl peptidase 1 precursor
  KO
K01275  cathepsin C [EC:3.4.14.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04142  Lysosome
rno04210  Apoptosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    25423 (Ctsc)
  09143 Cell growth and death
   04210 Apoptosis
    25423 (Ctsc)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    25423 (Ctsc)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:rno03110]
    25423 (Ctsc)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    25423 (Ctsc)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.14  Dipeptidyl-peptidases and tripeptidyl-peptidases
    3.4.14.1  dipeptidyl-peptidase I
     25423 (Ctsc)
Peptidases and inhibitors [BR:rno01002]
 Cysteine peptidases
  Family C1: papain family
   25423 (Ctsc)
Chaperones and folding catalysts [BR:rno03110]
 Intramolecular chaperones
  Papain family
   25423 (Ctsc)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   25423 (Ctsc)
SSDB
Motif
Pfam: Peptidase_C1 CathepsinC_exc Peptidase_C1_2 Pox_I6 Propeptide_C1
Other DBs
NCBI-GeneID: 25423
NCBI-ProteinID: NP_058793
RGD: 2445
Ensembl: ENSRNOG00000016496
UniProt: P80067
Structure
PDB: 
1JQP

Position
1
AA seq 462 aa
MGPWTHSLRAALLLVLLGVCTVSSDTPANCTYPDLLGTWVFQVGPRHPRSHINCSVMEPT
EEKVVIHLKKLDTAYDEVGNSGYFTLIYNQGFEIVLNDYKWFAFFKYEVKGSRAISYCHE
TMTGWVHDVLGRNWACFVGKKMANHSEKVYVNVAHLGGLQEKYSERLYSHNHNFVKAINS
VQKSWTATTYEEYEKLSIRDLIRRSGHSGRILRPKPAPITDEIQQQILSLPESWDWRNVR
GINFVSPVRNQESCGSCYSFASLGMLEARIRILTNNSQTPILSPQEVVSCSPYAQGCDGG
FPYLIAGKYAQDFGVVEENCFPYTATDAPCKPKENCLRYYSSEYYYVGGFYGGCNEALMK
LELVKHGPMAVAFEVHDDFLHYHSGIYHHTGLSDPFNPFELTNHAVLLVGYGKDPVTGLD
YWIVKNSWGSQWGESGYFRIRRGTDECAIESIAMAAIPIPKL
NT seq 1389 nt   +upstreamnt  +downstreamnt
atgggtccgtggacccactccttgcgcgccgccctgctgctggtgcttttgggagtctgc
accgtgagctccgacactcctgccaactgcacttaccctgacctgctgggtacctgggtt
ttccaggtgggccctagacatccccgaagtcacattaactgctcggtaatggaaccaaca
gaagaaaaggtagtgatacacctgaagaagttggatactgcctatgatgaagtgggcaat
tctgggtatttcaccctcatttacaaccaaggctttgagattgtgttgaatgactacaag
tggtttgcgtttttcaagtatgaagtcaaaggcagcagagccatcagttactgccatgag
accatgacagggtgggtccatgatgtcctgggccggaactgggcttgctttgttggcaag
aagatggcaaatcactctgagaaggtttatgtgaatgtggcacaccttggaggtctccag
gaaaaatattctgaaaggctctacagtcacaaccacaactttgtgaaggccatcaattct
gttcagaagtcttggactgcaaccacctatgaagaatatgagaaactgagcatacgagat
ttgataaggagaagtggccacagcggaaggatcctaaggcccaaacctgccccgataact
gatgaaatacagcaacaaattttaagtttgccagaatcttgggactggagaaacgtccgt
ggcatcaattttgttagccctgttcgaaaccaagaatcttgtggaagctgctactcattt
gcctctctgggtatgctagaagcaagaattcgtatattaaccaacaattctcagacccca
atcctgagtcctcaggaggttgtatcttgtagcccgtatgcccaaggttgtgatggtgga
ttcccatacctcattgcaggaaagtatgcccaagattttggggtggtggaagaaaactgc
tttccctacacagccacagatgctccatgcaaaccaaaggaaaactgcctccgttactat
tcttctgagtactactatgtgggtggtttctatggtggctgcaatgaagccctgatgaag
cttgagctggtcaaacacggacccatggcagttgcctttgaagtccacgatgacttcctg
cactaccacagtgggatctaccaccacactggactgagcgaccctttcaacccctttgag
ctgaccaatcatgctgttctgcttgtgggctatggaaaagatccagtcactgggttagac
tactggattgtcaagaacagctggggctctcaatggggtgagagtggctacttccggatc
cgcagaggaactgatgaatgtgcaattgagagtatagccatggcagccataccgattcct
aaattgtag

DBGET integrated database retrieval system