KEGG   Rattus norvegicus (rat): 25428Help
Entry
25428             CDS       T01003                                 

Gene name
Cyp7a1, CHAP, CYP7, CYP7S1
Definition
(RefSeq) cytochrome P450, family 7, subfamily a, polypeptide 1
  KO
K00489  cholesterol 7alpha-monooxygenase [EC:1.14.14.23]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00120  Primary bile acid biosynthesis
rno00140  Steroid hormone biosynthesis
rno01100  Metabolic pathways
rno03320  PPAR signaling pathway
rno04976  Bile secretion
rno04979  Cholesterol metabolism
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00120 Primary bile acid biosynthesis
    25428 (Cyp7a1)
   00140 Steroid hormone biosynthesis
    25428 (Cyp7a1)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    25428 (Cyp7a1)
  09154 Digestive system
   04976 Bile secretion
    25428 (Cyp7a1)
   04979 Cholesterol metabolism
    25428 (Cyp7a1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:rno00199]
    25428 (Cyp7a1)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.23  cholesterol 7alpha-monooxygenase
     25428 (Cyp7a1)
Cytochrome P450 [BR:rno00199]
 Cytochrome P450, animal type
  CYP7 family
   25428 (Cyp7a1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450 ALP_N
Motif
Other DBs
NCBI-GeneID: 25428
NCBI-ProteinID: NP_037074
RGD: 2482
Ensembl: ENSRNOG00000009488
UniProt: P18125
Position
5q12
AA seq 503 aa AA seqDB search
MMTISLIWGIAVLVSCCIWFIVGIRRRKAGEPPLENGLIPYLGCALKFGSNPLEFLRANQ
RKHGHVFTCKLMGKYVHFITNSLSYHKVLCHGKYFDWKKFHYTTSAKAFGHRSIDPNDGN
TTENINNTFTKTLQGDALCSLSEAMMQNLQSVMRPPGLPKSKSNAWVTEGMYAFCYRVMF
EAGYLTLFGRDISKTDTQKALILNNLDNFKQFDQVFPALVAGLPIHLFKTAHKAREKLAE
GLKHKNLCVRDQVSELIRLRMFLNDTLSTFDDMEKAKTHLAILWASQANTIPATFWSLFQ
MIRSPEAMKAASEEVSGALQSAGQELSSGGSAIYLDQVQLNDLPVLDSIIKEALRLSSAS
LNIRTAKEDFTLHLEDGSYNIRKDDMIALYPQLMHLDPEIYPDPLTFKYDRYLDESGKAK
TTFYSNGNKLKCFYMPFGSGATICPGRLFAVQEIKQFLILMLSCFELEFVESQVKCPPLD
QSRAGLGILPPLHDIEFKYKLKH
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgatgactatttctttgatttggggaattgccgtgttggtgagctgttgcatatggttt
attgttggaataaggagaaggaaagctggtgaacctcctttggagaacgggttgattccg
tacctgggctgtgctctgaaatttggatctaatcctcttgagttcctaagagctaatcaa
aggaagcatggtcacgtttttacctgcaaactgatggggaaatatgtccatttcatcaca
aactccctgtcataccacaaagtcttatgtcatggaaaatattttgactggaaaaaattt
cattacactacttctgcgaaggcatttggacacagaagcattgacccaaatgatggaaat
accacggaaaatataaacaacacttttaccaaaaccctccagggagatgctctgtgttca
ctttctgaagccatgatgcaaaacctccaatctgtcatgagacctcctggccttcctaaa
tcaaagagcaatgcctgggtcacggaagggatgtatgccttctgttaccgagtgatgttt
gaagctggctatctaacactgtttggcagagatatttcaaagacagacacacaaaaagca
cttattctaaacaaccttgacaacttcaaacaatttgaccaagtctttccggcactggtg
gcaggccttcctattcacttgttcaagaccgcacataaagctcgggaaaagctggctgag
ggattgaagcacaagaacctgtgtgtgagggaccaggtctctgaactgatccgtctacgt
atgtttctcaatgacacgctctccacctttgacgacatggagaaggccaagacgcacctc
gctattctctgggcatctcaagcaaacaccattcctgcaaccttttggagcttatttcaa
atgatcaggagtcctgaagcaatgaaagcagcctctgaagaagtgagtggagctttacag
agtgctggccaagagctcagctctggagggagtgccatttacttggatcaagtgcaactg
aatgacctgccggtactagacagcatcatcaaggaggctctgaggctttccagtgcatcc
ttgaatatccgcacagctaaggaggacttcactctccatcttgaggacggttcctataac
atccgaaaagatgacatgatagctctttatccacagttaatgcacttggatcctgaaatc
tacccagaccctttgactttcaaatatgaccggtaccttgatgaaagcgggaaagcaaag
accaccttctacagtaatggaaacaagctgaagtgtttctacatgcccttcggatcaggc
gcgacaatatgtcctggaagactctttgccgtccaagaaatcaagcagtttttgatcctg
atgctctcctgctttgaactggagtttgtggagagccaagtcaagtgtccccctctagac
cagtcccgggcaggcttgggaattttgccaccactacatgatattgagtttaaatataaa
ctgaaacactga

DBGET integrated database retrieval system