KEGG   Rattus norvegicus (rat): 25429
Entry
25429             CDS       T01003                                 

Gene name
Cyp7b1
Definition
(RefSeq) cytochrome P450, family 7, subfamily b, polypeptide 1
  KO
K07430  25/26-hydroxycholesterol 7alpha-hydroxylase [EC:1.14.14.29]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00120  Primary bile acid biosynthesis
rno00140  Steroid hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00120 Primary bile acid biosynthesis
    25429 (Cyp7b1)
   00140 Steroid hormone biosynthesis
    25429 (Cyp7b1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:rno00199]
    25429 (Cyp7b1)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.29  25/26-hydroxycholesterol 7alpha-hydroxylase
     25429 (Cyp7b1)
Cytochrome P450 [BR:rno00199]
 Cytochrome P450, animal type
  CYP7 family
   25429 (Cyp7b1)
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 25429
NCBI-ProteinID: NP_062011
RGD: 2483
Ensembl: ENSRNOG00000009730
UniProt: Q63688
Position
2q24
AA seq 507 aa
MEGATTPDAASPGPLSLLGLLFAVTLLLPVLFLLTRRTRRPCEPPLIKGWIPYLGMALKF
WKDPLAFLQTLQRQCGDTFTVLLGGKYITFVLNPFQYQYVMKNPKQLSFEKFSRRLSAKA
FSVKKLLTNDDLSNDIHRGYLLLQGKSLDGLLETMIQEVKEIFESRLLKLTDWNTARVFD
FCSSLVFEITFTTIYGKILAANKKQIISELRDDFLKFDDHFPYLVSDIPIQLLRNAEFMQ
KKIIKCLTPEKVAQMQRRSEIVQERQEMLKKYYGHEEFEIGAHHLGLLWASLANTIPAMF
WAMYYLLQHPEAMEVLRDEIDSFLQSTGQKKGPGISVHFTREQLDSLVCLESAILEVLRL
CSYSSIIREVQEDMDFSSESRSYRLRKGDFVAVFPPMIHNDPEVFDAPKDFRFDRFVEDG
KKKTTFFKGGKKLKSYIIPFGLGTSKCPGRYFAINEMKLLVIILLTYFDLEVIDTKPIGL
NHSRMFLGIQHPDSDISFRYKAKSWRS
NT seq 1524 nt   +upstreamnt  +downstreamnt
atggagggagccacgaccccagatgccgcttcgcccgggcctctctccctactaggcctt
ctctttgcggtcaccttgctgctcccagtcctgttcctcctcacccggcgcacaaggcgt
ccttgtgaacctcccttgataaaaggttggattccttatcttggcatggccctgaaattc
tggaaggatccgttagctttcttgcaaactcttcaaaggcaatgtggtgacactttcact
gtcttacttggagggaagtatataacatttgttctgaaccctttccagtaccagtatgta
atgaaaaacccaaaacaattaagctttgagaagttcagccgaagattatcagcgaaagcc
ttctctgtcaagaagctgctaactaatgacgaccttagcaatgacattcacagaggctat
cttcttttacaaggcaaatctctggatggtcttctggaaaccatgatccaagaagtaaaa
gaaatatttgagtccagactgctaaaactcacagattggaatacagcaagagtatttgat
ttctgtagttcactggtatttgaaatcacatttacaactatatatggaaaaattcttgct
gctaacaaaaaacaaattatcagtgagctgagggatgattttttaaaatttgatgaccat
ttcccatacttagtatctgacatacctattcagcttctaagaaatgcagaatttatgcag
aagaaaattataaaatgtctcacaccagaaaaagtagctcagatgcaaagacggtcagaa
attgttcaggagaggcaggagatgctgaaaaaatactacgggcatgaagagtttgaaata
ggagcacatcatcttggcttgctctgggcctctctagcaaacaccattccagctatgttc
tgggcaatgtattatcttcttcagcatccagaagctatggaagtcctgcgtgacgaaatt
gacagcttcctgcagtcaacaggtcaaaagaaaggacctggaatttctgtccacttcacc
agagaacaattggacagcttggtctgcctggaaagcgctattcttgaggttctgaggttg
tgctcctactccagcatcatccgtgaagtgcaagaggatatggatttcagctcagagagt
aggagctaccgtctgcggaaaggagactttgtagctgtctttcctccaatgatacacaat
gacccagaagtcttcgatgctccaaaggactttaggtttgatcgcttcgtagaagatggt
aagaagaaaacaacgtttttcaaaggaggaaaaaagctgaagagttacattataccattt
ggacttggaacaagcaaatgtccaggcagatactttgcaattaatgaaatgaagctacta
gtgattatacttttaacttattttgatttagaagtcattgacactaagcctataggacta
aaccacagtcgcatgtttctgggcattcagcatccagactctgacatctcatttaggtac
aaggcaaaatcttggagatcctga

DBGET integrated database retrieval system