KEGG   Rattus norvegicus (rat): 25432Help
Entry
25432             CDS       T01003                                 

Gene name
Drd4, D4RA
Definition
(RefSeq) dopamine receptor D4
  KO
K04147  dopamine receptor D4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04080  Neuroactive ligand-receptor interaction
rno04728  Dopaminergic synapse
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    25432 (Drd4)
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    25432 (Drd4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    25432 (Drd4)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Biogenic amine
   Dopamine
    25432 (Drd4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 25432
NCBI-ProteinID: NP_037076
RGD: 2522
Ensembl: ENSRNOG00000017927
UniProt: F1LLX2
Position
1q41
AA seq 387 aa AA seqDB search
MGNSSATGDGGLLAGRGPESLGTGTGLGGAGAGAAALVGGVLLIGMVLAGNSLVCVSVAS
ERILQTPTNYFIVSLAAADLLLAVLVLPLFVYSEGGVWLLSPRLCDTLMAMDVMLCTASI
FNLCAISVDRFVAVTVPLRYNQQGQCQLLLIAATWLLSAAVAAPVVCGLNDVPGRDPTVC
CLEDRDYVVYSSICSFFLPCPLMLLLYWATFRGLRRWEAARHTKLHSRAPRRPSGPGPPV
SDPTQGPLFSDCPPPSPSLRTSPTVSSRPESDLSQSPCSPGCLLPDAALAQPPAPSSRRK
RGAKITGRERKAMRVLPVVVGAFLMCWTPFFVVHITRALCPACFVSPRLVSAVTWLGYVN
SALNPIIYTIFNAEFRSVFRKTLRLRC
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atggggaacagcagcgctactggtgacggtgggctgttggccgggcgtgggccagagtcc
ttaggtactggcaccggacttgggggcgcgggcgcgggcgcggcggcgctggtgggaggc
gtgctgctcatcggcatggtgttggcagggaactcgctcgtttgcgtgagcgtggcctcc
gagcgcatcctgcagacacccaccaactacttcatcgtgagcctggcggctgccgacctc
ctcctcgcggtgctggtgttgcctctctttgtctactccgagggtggcgtgtggctgctg
agcccccgcctctgtgacaccctcatggccatggacgtcatgctgtgcaccgcctccatc
ttcaacctgtgcgccatcagcgtggacaggtttgtggctgtgaccgtgccactgcgctac
aaccagcagggtcagtgccagctgctgctcatcgccgccacgtggctgctgtctgccgcg
gtggctgcgcccgtcgtgtgcggcctcaatgatgtgcccggtcgcgatccaaccgtgtgc
tgcctggaggaccgcgactacgtggtctactcatccatttgttccttcttcctgccctgt
ccgctcatgctactgctttactgggccactttccgtggcttgcggcgctgggaggcagcc
cggcacaccaagcttcacagccgcgcgccgcgccgacccagcggcccgggcccgccggtg
tcggaccctactcagggtcccctcttctcagattgtccgcctccctcacccagcctccgg
acgagccccaccgtctccagcagaccagagtcagacctctctcagagcccctgcagcccc
gggtgtctgctccctgatgcagcgctcgcgcaaccgcctgcgccgtcttcccgcagaaag
agaggcgccaagatcactggaagggagcgcaaggcgatgagagtcctgccggtggtagtt
ggggccttcctgatgtgttggacgcctttcttcgtggtgcacatcacacgggcgctgtgt
ccggcttgtttcgtgtccccacgcctggtcagtgctgtcacctggctgggctatgtcaac
agtgccctcaaccccatcatctacaccatcttcaatgccgagtttcgaagtgtcttccgc
aagactcttcgtctccgctgctga

DBGET integrated database retrieval system