KEGG   Rattus norvegicus (rat): 25433
Entry
25433             CDS       T01003                                 

Gene name
Hbegf
Definition
(RefSeq) proheparin-binding EGF-like growth factor precursor
  KO
K08523  heparin-binding EGF-like growth factor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01522  Endocrine resistance
rno04012  ErbB signaling pathway
rno04912  GnRH signaling pathway
rno04915  Estrogen signaling pathway
rno04928  Parathyroid hormone synthesis, secretion and action
rno05171  Coronavirus disease - COVID-19
rno05205  Proteoglycans in cancer
rno05219  Bladder cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    25433 (Hbegf)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    25433 (Hbegf)
   04915 Estrogen signaling pathway
    25433 (Hbegf)
   04928 Parathyroid hormone synthesis, secretion and action
    25433 (Hbegf)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    25433 (Hbegf)
  09162 Cancer: specific types
   05219 Bladder cancer
    25433 (Hbegf)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    25433 (Hbegf)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    25433 (Hbegf)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    25433 (Hbegf)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   25433 (Hbegf)
SSDB
Motif
Pfam: EGF Syndecan
Other DBs
NCBI-GeneID: 25433
NCBI-ProteinID: NP_037077
RGD: 2526
Ensembl: ENSRNOG00000018646
UniProt: Q06175
Position
18
AA seq 208 aa
MKLLPSVVLKLFLAAVLSALVTGESLERLRRGLAAATSNPDPPTGTTNQLLPTGADRAQE
VQDLEGTDLDLFKVAFSSKPQALATPGKEKNGKKKRKGKGLGKKRDPCLKKYKDYCIHGE
CRYLKELRIPSCHCLPGYHGQRCHGLTLPVENPLYTYDHTTVLAVVAVVLSSVCLLVIVG
LLMFRYHRRGGYDLESEEKVKLGMASSH
NT seq 627 nt   +upstreamnt  +downstreamnt
atgaagctgctgccgtcggtggtgctgaagctctttctggccgcagtgttgtccgcgttg
gtgaccggtgagagtctggagcggcttcggagaggtctggcggcagcaaccagcaaccct
gaccctcccactggaaccacaaaccagctgctacccacgggagctgatcgcgctcaggag
gtccaggacttggaagggaccgatctggaccttttcaaagttgctttctcctccaagcca
caagccctggccaccccaggaaaagaaaagaacgggaaaaagaagaggaaaggcaagggg
ttaggaaagaagagagatccatgccttaagaaatacaaggactactgcatccacggagag
tgcagatacctgaaggagctccgtattccctcgtgccactgcctccctggttaccatgga
cagaggtgtcatgggctgaccctaccggtagagaaccccctgtacacatatgaccacact
accgtcttggctgtggtggctgtagtactgtcatctgtctgtcttcttgtcatcgtggga
cttctcatgttcaggtaccataggcgaggaggttatgacttggaaagtgaggagaaagtg
aagttgggcatggctagctcccactga

DBGET integrated database retrieval system