KEGG   Rattus norvegicus (rat): 25435
Entry
25435             CDS       T01003                                 

Gene name
Eef2k, SMEF2K
Definition
(RefSeq) eukaryotic elongation factor-2 kinase
  KO
K08292  elongation factor 2 kinase [EC:2.7.11.20]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04152  AMPK signaling pathway
rno04921  Oxytocin signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    25435 (Eef2k)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    25435 (Eef2k)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    25435 (Eef2k)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.20  elongation factor 2 kinase
     25435 (Eef2k)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: Other
  Alpha family [OT]
   25435 (Eef2k)
SSDB
Motif
Pfam: Alpha_kinase Sel1 DUF1771
Other DBs
NCBI-GeneID: 25435
NCBI-ProteinID: NP_037079
RGD: 2538
Ensembl: ENSRNOG00000016448
UniProt: P70531
Position
1q36
AA seq 724 aa
MADEDLIFRLEGVDGGGSSGAGRHGDSDTDSDDDEGYFICPITDDHMSNQNVNSKGQGYY
NNLLKTECGSTGSPASSFHFKEAWKHAIEKAKHMPDPWAEFHLEDIATEHATRHRYNAVT
GEWLKDEVLIKMASQPFGRGAMRECFRTKKLSNFLHAQHWKGASNYVAKRYLEPVDRSVY
FEDVQLQMEAKLWGEEYNRHKPPKQVDIMQMCIIELKDRQGQPLFHLEHYIEGKYIKYNS
NSGFVRDDNIRLTPQAFSHFTFERSGHQLIVVDIQGVGDLYTDPQIHTEKGTDFGDGNLG
VRGMALFFYSHACNRICQSMGLAPFDLSPREQDAVNQSTKLLQSAKTILRGTEEKCGSPR
IRTLSGSRPPLLLRLSENSGDENMSDVTFDSLPSSPSSATPHSQKLDHLHWPVFGDLDNM
GPRDHDRMDNHRDSENSGDSGYPSEKRSDLDDPEPREHGHSNGNRRPESDEDSLGSSGRV
CVETWNLLNPSRLHLPRPSAVALEVQRLNALDLGRKIGKSVLGKVHLAMVRYHEGGRFCE
KDEEWDQESAIFHLEHAADLGELEAIVGLGLMYSQLPHHILADVSLEETEENKTKGFDYL
LKAAEAGDRQSMILVARAFDTGLNLSPDRCQDWSEALHWYNTALETTDCDEGGEYDGIQD
EPQYALLAREAEMLLTGGFGLDKNPQRSGDLYTQAAEAAMEAMKGRLANQYYEKAEEAWA
QMEE
NT seq 2175 nt   +upstreamnt  +downstreamnt
atggcagacgaagacctcatcttccgcctggaaggtgttgacggtggcgggtcctccgga
gctggccgccatggggactctgacacagacagtgacgatgatgagggctacttcatctgc
cccatcactgatgaccacatgtccaaccagaatgtcaactccaaaggccagggctactac
aacaacctactgaaaacggagtgtggctccacagggtcaccagccagctccttccacttc
aaggaggcctggaagcatgcgatcgagaaggccaagcacatgcccgacccctgggctgaa
ttccatctggaggacatcgccacagagcatgctactcggcacaggtacaatgctgtcacc
ggggagtggctgaaagacgaggttctgatcaagatggcatctcagcccttcggccgtgga
gcaatgagggagtgcttcaggacgaagaaactctccaacttcttgcatgcccagcattgg
aagggggcctccaactacgtggcaaaacgctacctcgagccagtggacaggagcgtgtac
tttgaggatgtgcagctccagatggaagcgaagctctggggggaggagtacaaccggcac
aagccccccaagcaggtagatatcatgcagatgtgcatcattgagctaaaggacagacaa
ggacagcccctcttccacctggagcactacattgagggcaagtacatcaagtataattcc
aactcaggctttgtccgtgatgacaacatcagactaacaccacaggccttcagccatttc
acatttgaacgttctggtcatcagctgattgtagtggacatccagggtgtgggcgacctt
tatactgacccacagatccacactgagaaaggcactgactttggagatggtaaccttggt
gtccggggaatggctctcttcttctactctcatgcctgcaaccgtatttgccagagcatg
ggccttgcgccctttgacctctccccacgggagcaggatgccgtgaaccagagcaccaag
ctgttgcaatcagccaagaccatcttgagggggacagaggagaagtgtgggagtccccgc
ataaggacactctctggcagccggccccccttgctccttcgcctgtcagagaactctggg
gatgagaacatgagtgatgtgacctttgactctctgccttcctccccgtcttcagccaca
ccacacagccagaagttggaccacctccattggccagtgtttggtgacctcgataacatg
ggccctagagaccatgaccgcatggacaatcaccgggactctgagaatagtggggacagt
gggtatccaagcgagaagcgaagtgacctggatgatcctgagccccgagaacacggccac
tccaatggcaaccgaaggcctgaatctgatgaggacagcctgggcagctctggacgggtc
tgtgtggagacgtggaacctgctcaatccctcccgcctgcacctgcccaggccctcggcc
gtggccctagaagtgcaaaggttaaatgctctggaccttggaaggaaaatcgggaagtct
gttttggggaaggtccatctggccatggtacggtaccacgagggcgggcgcttctgcgag
aaggatgaggaatgggatcaagagtctgccatcttccatctggagcatgcagccgacctg
ggagaactggaggccatcgtgggcctaggcctcatgtactctcagctgccccaccacatc
ctggctgatgtctctctggaggagacagaagagaacaagacaaaaggctttgattacctc
ctgaaggccgcagaagctggtgacaggcagtccatgattttagtggctcgagcttttgac
accggcctgaacctcagcccagacaggtgtcaagactggtcggaagccttacactggtac
aacacggccctggagacgacggactgcgatgaaggcggggagtatgacggaatacaggac
gagccccagtatgcactgctggccagggaggcagagatgttgctcaccggtggatttgga
ctggacaagaacccccaaagatcaggagacttgtacacccaggcagccgaggcagcaatg
gaagccatgaagggccggctagccaaccagtactatgagaaggcggaagaggcctgggcg
caaatggaggaataa

DBGET integrated database retrieval system