KEGG   Rattus norvegicus (rat): 25437Help
Entry
25437             CDS       T01003                                 

Gene name
Emd
Definition
(RefSeq) emerin
  KO
K12569  emerin
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05410  Hypertrophic cardiomyopathy (HCM)
rno05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
rno05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    25437 (Emd)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    25437 (Emd)
   05414 Dilated cardiomyopathy (DCM)
    25437 (Emd)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LEM
Motif
Other DBs
NCBI-GeneID: 25437
NCBI-ProteinID: NP_037080
RGD: 2551
Ensembl: ENSRNOG00000058882
UniProt: Q63190
Position
Xq37
AA seq 260 aa AA seqDB search
MDDYAVLSDTELAAVLRQYNIPHGPILGSTRKLYEKKIFEYETQRRRLSPPSSSSSSFSY
RFSDLDSASVDSDMYDLPKKEDALLYQSKDYNDDYYEESYLTTRTYGEPESVGMSKSFRR
PGTSLVDADDTFHHQVRDDIFSSSEEEGKDRERPIYGRDSAYQSIAEYRPISNVSRSSLG
LSYYPRSSTSSVSSSSSSPSSWLTRRAIRPEKQAPTAALGQDRQVPLWGQLLLFLAFATF
LLFVYYSIQAQEGNPFWMDP
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggacgactatgcggttttgtccgatactgagctggccgcagtgctacgccagtacaac
atcccgcatgggcctattctgggctccactcgcaagctctacgaaaagaaaatcttcgag
tacgagacccagagaaggaggctttcgccccccagctcgtcatcgtcttcattctcctat
cggttctcagacttggattcagcctccgtggactcagacatgtatgatctgcccaaaaag
gaggacgccttactttaccagagcaaggactataatgatgactactatgaggagagctat
ttgactaccaggacatacggggagcccgagtctgtgggcatgtccaagagcttccgccgg
ccagggacctcacttgtagatgctgatgataccttccatcaccaggtgcgtgatgacatt
ttctcttcttcagaagaggaaggcaaggatagggaacgccccatctatggccgagacagt
gcctaccagagcatcgcagagtaccgccccatttccaatgtctccaggagctccctgggc
ttatcatattatcctagatcctccacctcttctgtgtcctcctcttcatcttctccctct
tcatggcttacccgacgtgccattcgaccagaaaagcaggcccctactgctgctctgggc
caggatcgacaggtcccactctggggccagctgttactcttcctggcctttgctaccttt
ctgctctttgtttactattccatacaagctcaagaaggcaaccccttctggatggatccc
taa

DBGET integrated database retrieval system