KEGG   Rattus norvegicus (rat): 25438
Entry
25438             CDS       T01003                                 

Gene name
Eno3, BBE, MSE
Definition
(RefSeq) enolase 3
  KO
K01689  enolase [EC:4.2.1.11]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00010  Glycolysis / Gluconeogenesis
rno01100  Metabolic pathways
rno01200  Carbon metabolism
rno01230  Biosynthesis of amino acids
rno03018  RNA degradation
rno04066  HIF-1 signaling pathway
Module
rno_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
rno_M00002  Glycolysis, core module involving three-carbon compounds
rno_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    25438 (Eno3)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    25438 (Eno3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    25438 (Eno3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    25438 (Eno3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    25438 (Eno3)
Enzymes [BR:rno01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.11  phosphopyruvate hydratase
     25438 (Eno3)
Messenger RNA biogenesis [BR:rno03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     25438 (Eno3)
Exosome [BR:rno04147]
 Exosomal proteins
  Proteins found in most exosomes
   25438 (Eno3)
SSDB
Motif
Pfam: Enolase_C Enolase_N MR_MLE_C MAAL_C
Other DBs
NCBI-GeneID: 25438
NCBI-ProteinID: NP_037081
RGD: 2555
Ensembl: ENSRNOG00000004078
UniProt: P15429
Position
10q24
AA seq 434 aa
MAMQKIFAREILDSRGNPTVEVDLHTAKGRFRAAVPSGASTGIYEALELRDGDKSRYLGK
GVLKAVEHINKTLGPALLEKKLSVVDQEKVDKFMIELDGTENKSKFGANAILGVSLAVCK
AGAAEKGVPLYRHIADLAGNPDLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASSFKE
AMRIGAEVYHHLKGVIKAKYGKDATNVGDEGGFAPNILENNEALELLKTAIQAAGYPDKV
VIGMDVAASEFYRNGKYDLDFKSPDDPARHISGEKLGELYKSFIKNYPVVSIEDPFDQDD
WATWTSFLSGVDIQIVGDDLTVTNPKRIAQAVEKKACNCLLLKVNQIGSVTESIQACKLA
QSNGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTGAPCRSERLAKYNQLMRIEEALGDK
AVFAGRKFRNPKAK
NT seq 1305 nt   +upstreamnt  +downstreamnt
atggccatgcaaaaaatctttgcccgagaaatcctggactccaggggcaaccccacagtg
gaggtggacctgcacacagccaagggtcgattccgagcggctgtgccaagcggagcttcc
acgggtatctatgaagcactggagctacgagatggagacaaatcacgatacctggggaaa
ggagtgctgaaggctgtggagcacatcaacaagactctcggccctgctctgctggaaaag
aaactaagtgttgtggatcaagaaaaagttgacaaatttatgattgagctggacggaacc
gagaataagtccaagtttggggccaatgccatcctgggtgtgtccctggctgtttgtaag
gctggagcagctgagaaaggggtccctctctaccgacacattgcagacctcgcagggaat
cccgaccttgtacttcccgtgcctgccttcaatgtgatcaacgggggctctcatgctgga
aacaagttggccatgcaggagttcatgattctgccagtgggagccagctctttcaaggaa
gccatgcgcattggcgctgaggtctaccaccacctcaagggggtcatcaaagccaagtat
gggaaggatgccaccaatgtgggggacgagggtggctttgcacccaacatcctggagaac
aatgaggccctggaactactaaagacagccattcaggcagctggttacccagacaaggtg
gtgattggcatggatgtggcagcatctgaattctatcgcaatgggaagtatgatctggac
ttcaagtcacctgatgatcctgcgaggcacatcagtggggagaagctcggggagctgtac
aagtccttcatcaagaactatcccgtggtctccattgaagacccctttgaccaggatgac
tgggcaacatggacctcattcctctctggggtggacatccagattgtgggagatgacctg
acagtcaccaaccccaagaggattgctcaggctgttgagaagaaggcctgcaattgcctg
ctgctgaaggtcaaccagatcggctctgtgacagaatccatccaggcctgtaaactggca
cagtctaatggctggggagtgatggtgagccaccgctctggggagaccgaagacactttc
attgctgatcttgtggtgggactctgcacaggacagatcaagactggtgctccctgccgt
tcagagcgtctggcaaaatacaaccagcttatgaggattgaggaggctctcggagacaaa
gctgtctttgctggacgaaagttccgtaatccaaaggccaaatga

DBGET integrated database retrieval system