KEGG   Rattus norvegicus (rat): 25439
Entry
25439             CDS       T01003                                 

Gene name
F2r
Definition
(RefSeq) proteinase-activated receptor 1 precursor
  KO
K03914  coagulation factor II (thrombin) receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04015  Rap1 signaling pathway
rno04020  Calcium signaling pathway
rno04024  cAMP signaling pathway
rno04072  Phospholipase D signaling pathway
rno04080  Neuroactive ligand-receptor interaction
rno04151  PI3K-Akt signaling pathway
rno04610  Complement and coagulation cascades
rno04611  Platelet activation
rno04810  Regulation of actin cytoskeleton
rno05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    25439 (F2r)
   04020 Calcium signaling pathway
    25439 (F2r)
   04072 Phospholipase D signaling pathway
    25439 (F2r)
   04024 cAMP signaling pathway
    25439 (F2r)
   04151 PI3K-Akt signaling pathway
    25439 (F2r)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    25439 (F2r)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    25439 (F2r)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    25439 (F2r)
   04611 Platelet activation
    25439 (F2r)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    25439 (F2r)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    25439 (F2r)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Peptide
   Thrombin
    25439 (F2r)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 25439
NCBI-ProteinID: NP_037082
RGD: 2586
UniProt: Q5U324
Position
2
AA seq 432 aa
MGPRRLLLVAVGLSLCGPLLSSRVPMRQPESERMYATPYATPNPRSFFLRNPSEDTFEQF
PLGDEEEKNESIPLEGRAVYLNKSRFPPMPPPPFISEDASGYLTSPWLTLFIPSVYTFVF
IVSLPLNILAIAVFVFRMKVKKPAVVYMLHLAMADVLFVSVLPFKISYYFSGTDWQFGSG
MCRFATAAFYCNMYASIMLMTVISIDRFLAVVYPIQSLSWRTLGRANFTCVVIWVMAIMG
VVPLLLKEQTTQVPGLNITTCHDVLNETLLHGFYSYYFSAFSAIFFLVPLIISTVCYTSI
IRCLSSSAVANRSKKSRALFLSAAVFCIFIVCFGPTNVLLIVHYLLLSDSPGTETAYFAY
LLCVCVSSVSCCIDPLIYYYASSECQKHLYSILCCRESSDSNSCNSTGQLMPSKMDTCSS
HLNNSIYKKLLA
NT seq 1299 nt   +upstreamnt  +downstreamnt
atggggccccggcgcttgctgctcgtcgcggtcggcctcagcctgtgcggtcctttgctg
tcttcccgcgttcctatgagacagccagaatctgagaggatgtatgctacgccgtatgct
acgccaaacccccgctcattttttctcaggaatcccagtgaagatacatttgaacagttc
cccctaggggatgaggaggagaaaaatgaaagcataccgctcgagggcagggcagtctac
ttaaataaaagccgttttcctcccatgccgcctcctcccttcatctccgaggacgcctcc
ggatatctgaccagcccctggctgacgctcttcataccctccgtgtacacgtttgtgttc
atagtcagccttcccctgaacatcctggccatcgctgtgtttgtctttcggatgaaggtc
aagaagccggccgtggtgtacatgctgcacctggccatggccgatgtcctcttcgtgtcc
gtgctccccttcaagatcagctactacttctccggcaccgattggcagttcgggtccgga
atgtgtcgcttcgccaccgcagcgttttattgtaacatgtacgcctccatcatgctcatg
acagtcataagcattgaccggttcctggcagtggtgtaccccatccagtccctgtcctgg
cgcactctgggccgagccaacttcacctgcgtggtcatctgggtgatggccatcatgggg
gtggtgcccctcctcctcaaagagcagaccacccaggttccggggctcaacatcaccacc
tgccacgacgtcctcaacgagaccctgctgcatggcttttactcgtactatttctccgcc
ttctccgccatcttctttcttgtgccgttgatcatttccacagtctgctacacgtccatc
atccgatgcctcagctcctccgcggtggcgaaccggagcaagaagtcgcgggctttgttc
ctgtccgccgccgtgttctgcatcttcatcgtctgctttgggcccaccaacgtcctcctg
attgtgcactacctgctcctctccgacagtcctggcacagagacggcctattttgcttac
ctcctctgcgtctgcgtgagcagcgtgagctgctgcatcgaccccttgatttactactat
gcctcctccgagtgccagaagcacctttacagcattttgtgctgcagagaaagctctgat
tccaacagttgcaacagcaccggccagctgatgcccagtaagatggatacctgctctagc
cacctgaataatagcatatacaaaaagctactagcttag

DBGET integrated database retrieval system