KEGG   Rattus norvegicus (rat): 25441
Entry
25441             CDS       T01003                                 

Gene name
Fcer1g
Definition
(RefSeq) Fc fragment of IgE receptor Ig
  KO
K07983  high affinity immunoglobulin epsilon receptor subunit gamma
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04071  Sphingolipid signaling pathway
rno04072  Phospholipase D signaling pathway
rno04611  Platelet activation
rno04625  C-type lectin receptor signaling pathway
rno04650  Natural killer cell mediated cytotoxicity
rno04664  Fc epsilon RI signaling pathway
rno05152  Tuberculosis
rno05310  Asthma
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    25441 (Fcer1g)
   04071 Sphingolipid signaling pathway
    25441 (Fcer1g)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    25441 (Fcer1g)
   04625 C-type lectin receptor signaling pathway
    25441 (Fcer1g)
   04650 Natural killer cell mediated cytotoxicity
    25441 (Fcer1g)
   04664 Fc epsilon RI signaling pathway
    25441 (Fcer1g)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    25441 (Fcer1g)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    25441 (Fcer1g)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    25441 (Fcer1g)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   25441 (Fcer1g)
SSDB
Motif
Pfam: TCR_zetazeta ITAM
Other DBs
NCBI-GeneID: 25441
NCBI-ProteinID: NP_001124473
RGD: 2599
Ensembl: ENSRNOG00000024159
UniProt: P20411 B1H251
Position
13q24
AA seq 86 aa
MIPAVILFLLLLVEEAAALGEPQLCYILDAILFLYGIVLTLLYCRLKIQVRKADIASREK
SDAVYTGLNTRNQETYETLKHEKPPQ
NT seq 261 nt   +upstreamnt  +downstreamnt
atgatcccagcggtgatcttgttcttgctccttttggtggaagaagcagctgccctagga
gagccgcagctctgctatatcctggatgccatcctgtttttgtatggtattgtccttacc
ctgctctactgtcgactcaagatccaggtccgaaaggcagacatagccagccgtgagaaa
tcagatgctgtctacacgggcctgaacacccggaaccaggagacatatgagactctgaaa
catgagaaaccaccccaatag

DBGET integrated database retrieval system