KEGG   Rattus norvegicus (rat): 25447
Entry
25447             CDS       T01003                                 

Gene name
Fshb
Definition
(RefSeq) follitropin subunit beta precursor
  KO
K05250  follitropin subunit beta
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04024  cAMP signaling pathway
rno04080  Neuroactive ligand-receptor interaction
rno04912  GnRH signaling pathway
rno04913  Ovarian steroidogenesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    25447 (Fshb)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    25447 (Fshb)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    25447 (Fshb)
   04913 Ovarian steroidogenesis
    25447 (Fshb)
SSDB
Motif
Pfam: Cys_knot
Other DBs
NCBI-GeneID: 25447
NCBI-ProteinID: NP_001007598
RGD: 2630
Ensembl: ENSRNOG00000004898
UniProt: P18427 B5DEM1
Position
3
AA seq 130 aa
MMKSIQLCILLWCLRAVCCHSCELTNITISVEKEECRFCISINTTWCEGYCYTRDLVYKD
PARPNTQKVCTFKELVYETIRLPGCARHSDSLYTYPVATECHCGKCDSDSTDCTVRGLGP
SYCSFGEMKE
NT seq 393 nt   +upstreamnt  +downstreamnt
atgatgaagtcgatccagctttgcatcctactctggtgcttgagagcagtctgctgccat
agctgtgaactgaccaacatcaccatctcagtagagaaggaagagtgccgtttctgcata
agcatcaataccacttggtgtgagggctactgctacaccagggatctggtgtataaggac
ccagctagaccaaacacccagaaagtatgcaccttcaaggagctggtgtacgagaccata
agattgcctggctgtgcccgccactcagactccctctacacatatccagtagccactgaa
tgccactgtggcaagtgtgatagtgacagcaccgactgcactgtaagaggcctgggaccc
agctactgctccttcggtgaaatgaaagaataa

DBGET integrated database retrieval system