KEGG   Rattus norvegicus (rat): 25450
Entry
25450             CDS       T01003                                 

Gene name
Gabrb1, GARB1
Definition
(RefSeq) gamma-aminobutyric acid type A receptor beta 1 subunit
  KO
K05181  gamma-aminobutyric acid receptor subunit beta
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04080  Neuroactive ligand-receptor interaction
rno04723  Retrograde endocannabinoid signaling
rno04726  Serotonergic synapse
rno04727  GABAergic synapse
rno05032  Morphine addiction
rno05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    25450 (Gabrb1)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    25450 (Gabrb1)
   04726 Serotonergic synapse
    25450 (Gabrb1)
   04723 Retrograde endocannabinoid signaling
    25450 (Gabrb1)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    25450 (Gabrb1)
   05033 Nicotine addiction
    25450 (Gabrb1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    25450 (Gabrb1)
Ion channels [BR:rno04040]
 Ligand-gated channels
  GABA-A
   25450 (Gabrb1)
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb OAD_gamma
Other DBs
NCBI-GeneID: 25450
NCBI-ProteinID: NP_037088
RGD: 2649
Ensembl: ENSRNOG00000002327
UniProt: P15431
Structure
PDB: 
6DW1 6DW0

Position
14p11
AA seq 474 aa
MWTVQNRESLGLLSFPVMVAMVCCAHSSNEPSNMSYVKETVDRLLKGYDIRLRPDFGGPP
VDVGMRIDVASIDMVSEVNMDYTLTMYFQQSWKDKRLSYSGIPLNLTLDNRVADQLWVPD
TYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIE
SYGYTTDDIEFYWNGGEGAVTGVNKIELPQFSIVDYKMVSKKVEFTTGAYPRLSLSFRLK
RNIGYFILQTYMPSTLITILSWVSFWINYDASAARVALGITTVLTMTTISTHLRETLPKI
PYVKAIDIYLMGCFVFVFLALLEYAFVNYIFFGKGPQKKGASKQDQSANEKNKLEMNKVQ
VDAHGNILLSTLEIRNETSGSEVLTGVSDPKATMYSYDSASIQYRKPLSSREGFGRGLDR
HGVPGKGRIRRRASQLKVKIPDLTDVNSIDKWSRMFFPITFSLFNVVYWLYYVH
NT seq 1425 nt   +upstreamnt  +downstreamnt
atgtggacagtacaaaatcgagagagtttggggcttctctcttttcctgtgatggttgcc
atggtttgttgtgcacacagctccaatgaacccagcaacatgtcatacgtgaaagagaca
gtggaccgactgctcaaaggatatgacattcgcttgcggccagactttggagggcccccg
gtggacgtcgggatgcggatcgatgtcgccagcatagacatggtctcggaagtgaatatg
gattatacactcaccatgtatttccagcagtcttggaaggacaagagactttcatattct
ggaatcccattaaatctgacccttgacaacagggtagctgaccaactctgggtaccagac
acctactttctcaatgacaagaagtcatttgtgcatggggtcacagtgaaaaaccgaatg
atcaggcttcatcctgatggaactgttctctatggactacggatcacaaccactgcagct
tgcatgatggatctccgaagataccctctggatgagcaaaactgcaccctggagatcgaa
agttatggctataccaccgatgacatcgaattttactggaatggaggagagggagcagta
actggggtcaataaaattgagcttccccaattttcaattgtcgactacaagatggtgtcc
aagaaggtggaattcacaacaggggcatatccacgactatcactaagttttcgtctaaag
agaaacatcggttacttcattttgcagacctacatgccctccacactgattacaattctg
tcctgggtgtcgttttggatcaactatgatgcatctgcagccagagtcgccctaggaatc
accacggtgctgaccatgacaaccatcagtactcacctcagggagactctgccaaagatc
ccttacgtcaaagcgattgatatctatctcatgggttgttttgtgttcgtgttcctggct
ctactggagtacgcctttgtaaattacattttcttcggaaaaggccctcagaaaaaagga
gcgagcaaacaagaccagagtgccaatgaaaagaacaaactggagatgaacaaagtccag
gttgatgcccacggcaatattctcctcagcaccctggaaatcaggaatgagaccagtggc
tccgaggtgctcacgggtgtaagtgaccccaaggccactatgtactcatacgacagcgcc
agcatccagtaccgcaaaccactgagcagccgtgagggcttcggacgagggctggacagg
cacggggtgcccggcaagggtcgcatccgcagacgtgcctctcagctcaaagtgaagatc
cctgacttgactgacgtgaactccatagacaagtggtcccgaatgttcttccccatcaca
ttttccctttttaatgtcgtttattggctttactatgtacactaa

DBGET integrated database retrieval system