KEGG   Rattus norvegicus (rat): 25455Help
Entry
25455             CDS       T01003                                 

Gene name
Ggh
Definition
(RefSeq) gamma-glutamyl hydrolase
  KO
K01307  gamma-glutamyl hydrolase [EC:3.4.19.9]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00790  Folate biosynthesis
rno01523  Antifolate resistance
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    25455 (Ggh)
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    25455 (Ggh)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:rno01002]
    25455 (Ggh)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.9  folate gamma-glutamyl hydrolase
     25455 (Ggh)
Peptidases [BR:rno01002]
 Cysteine Peptidases
  Family C26: gamma-glutamyl hydrolase family
   25455 (Ggh)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C26 GATase SNO DUF3944
Motif
Other DBs
NCBI-GeneID: 25455
NCBI-ProteinID: NP_037092
RGD: 2682
Ensembl: ENSRNOG00000007351
UniProt: Q62867
Position
5q13
AA seq 317 aa AA seqDB search
MASLGRLLCAWVLLLCGLASPGLSGSYERGSKRPIIGIIMQECYGNMTKLGRFYIAASYV
KFIESAGARVVPIRLDLNDAQYETLFRSINGVLLPGGGANLTHSGYSRVAKIFFTKALES
FDNGDYFPVWGTCLGLEELSVLVSNDNLLTLTNTSSVKLPLNFTRDSKQSRMFRNLPEEL
LNSLASENLTANFHKWSLSVKNFTENEKLKKFFNILTVNTDGKTEFISSMEGYKYPIYAV
QWHPEKAPFEWKKLRGISHAPNAVKTSFYLAKFFISEALKNDHHFENELEETESLIYQFC
PVYTGNISSFQQAYMFN
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atggcaagcctgggccgcctgctgtgcgcatgggttttgctgctgtgcgggcttgcaagc
cccgggctgtccggatcctatgagcgcggctccaagcgtcccatcatcggaataataatg
caagaatgttatgggaacatgacgaagttgggaagattctacattgctgcgtcctatgtg
aagtttatagagtctgcgggtgcaagagtcgtgcccataaggctcgaccttaatgatgca
cagtatgaaacactttttagatctattaatggagtcctcttgcctggagggggtgctaac
ctaacacattcaggttattcccgtgtggccaaaatatttttcaccaaggctctagagagt
tttgataatggagactattttcctgtgtggggaacatgcctgggattggaggagctttcc
gtcctggttagtaatgacaacttactgacactcacaaacaccagctcagtgaaattgcct
ttgaacttcacgagagattcaaagcagagcagaatgttccggaatcttcctgaggagtta
ttgaattcattagcatcagaaaatctgactgcaaattttcacaagtggagcctgtctgtg
aagaactttacagaaaacgagaagttaaagaagtttttcaatatattaacagtcaataca
gatggcaagactgagttcatttcatccatggaaggatataagtatccaatatatgctgtc
cagtggcatcctgagaaagcaccatttgagtggaagaaactgcgaggcatttcccatgca
ccgaatgctgtgaagacttcattttacttagcaaaattttttatttctgaagctctgaaa
aatgatcaccactttgagaacgaacttgaagagactgaatccttgatttaccagttctgt
ccagtttatactggaaatatttcttcatttcagcaagcttatatgtttaactga

DBGET integrated database retrieval system