KEGG   Rattus norvegicus (rat): 25458
Entry
25458             CDS       T01003                                 

Gene name
Gss
Definition
(RefSeq) glutathione synthetase
  KO
K21456  glutathione synthase [EC:6.3.2.3]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00270  Cysteine and methionine metabolism
rno00480  Glutathione metabolism
rno01100  Metabolic pathways
rno01240  Biosynthesis of cofactors
rno04216  Ferroptosis
Module
rno_M00118  Glutathione biosynthesis, glutamate => glutathione
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    25458 (Gss)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    25458 (Gss)
 09140 Cellular Processes
  09143 Cell growth and death
   04216 Ferroptosis
    25458 (Gss)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    25458 (Gss)
Enzymes [BR:rno01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.3  glutathione synthase
     25458 (Gss)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   25458 (Gss)
SSDB
Motif
Pfam: GSH_synth_ATP GSH_synthase
Other DBs
NCBI-GeneID: 25458
NCBI-ProteinID: NP_037094
RGD: 2752
Ensembl: ENSRNOG00000018964
UniProt: P46413
Position
3
AA seq 474 aa
MATSWGSILQDEKQLEELAQQAIDRALAEGVLLRSAKNPSSSDVVTYAPFTLFPSPVPST
LLEQAYAVQMDFNILVDAVSQNSAFLEQTLSSTIKKDEYTARLFDIYKQVLKEGIAQTVF
LGLNRSDYMFQCSADGSKALKQIEINTISASFGGLASRTPAVHRHVLNVLNKTNEASKIL
SNNPSKGLALGIAKAWELYGSANAVVLLIAQEKERNIFDQRAIENELLDRKIHVIRRRFE
DVSERGSLDQNRRLFMEDQEVAVVYFRDGYMPSQYNAQNWEARLLLERSCAAKCPDIATQ
LAGTKKVQQELSRVGLLEALLPGQPEAVARLRATFAGLYSLDMGEEGDQAVAEALAAPSH
FVLKPQREGGGNNFYGEEMVHALEQLKDSEERASYILMEKIEPEPFRNCLLRPGSPAQVV
QCISELGIFGVYVRQGTTLVMNKHVGHLLRTKAIEHADGGVAAGVAVLDNPYPV
NT seq 1425 nt   +upstreamnt  +downstreamnt
atggccaccagctggggaagcatcttgcaggatgagaagcagctggaagagttggcacag
caggccatagaccgggccctggctgagggggtgttgctgaggtccgcaaagaaccccagc
tcctctgacgtggtgacgtatgccccattcacgctcttcccctcaccagtgcccagcact
ctgctggagcaggcctatgctgtgcagatggacttcaacatcctggtagatgctgtcagc
cagaactccgccttcctggagcaaacactgtctagcaccatcaaaaaggatgagtatact
gcccgtctctttgatatctacaagcaagtcctgaaagagggcatagcccagactgtgttc
ctgggcctcaatcgttcagattacatgttccagtgcagcgcagacggctccaaagccctg
aaacagattgagatcaacactatctctgccagctttgggggcctggcctcccggactccg
gctgtgcaccgacatgttctcaatgtcctgaataagaccaacgaagcttccaagatcctg
tccaacaaccccagcaagggactggccctggggatcgccaaagcctgggagctctatggc
tcagccaatgccgtggtgctactgattgctcaggagaaggaaaggaacatatttgaccag
cgtgccatagagaacgagctgctagacaggaagatccatgtaatccgccgaagatttgaa
gatgtctctgaaaggggttctctagaccaaaaccgaaggctgtttatggaggaccaggaa
gttgctgtggtttacttccgagatggctacatgcccagtcagtataacgcacagaactgg
gaagctcgcctgctgctagagagatcatgtgctgccaagtgtcccgacattgccacacag
ctggctggcactaagaaggtgcagcaggaactgagcagggtgggcctgctggaagcgctg
ctcccgggccagcccgaggctgtggcccgcctccgtgccacctttgctggcctctattca
ctggacatgggtgaagaaggggaccaggctgtcgctgaggcccttgctgcccctagccac
tttgtgctgaagccccaaagagagggcggaggtaataacttctatggggaggaaatggta
cacgctctggagcagctgaaagacagcgaggagagagcctcctacatcctcatggagaag
attgaacctgagccttttaggaattgcttactacggcctggcagccctgcccaagtggtc
cagtgcatctcggagctgggtatttttggagtctatgtcagacagggaacaacacttgtg
atgaacaagcatgtggggcatctgcttcgaaccaaagccattgaacatgcagatggaggt
gtggcagcaggagtggcagtcctggacaacccctaccctgtgtga

DBGET integrated database retrieval system