KEGG   Rattus norvegicus (rat): 25460
Entry
25460             CDS       T01003                                 

Gene name
Hmmr, RHAMM
Definition
(RefSeq) hyaluronan-mediated motility receptor
  KO
K06267  hyaluronan-mediated motility receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04512  ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    25460 (Hmmr)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:rno04090]
    25460 (Hmmr)
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    25460 (Hmmr)
CD molecules [BR:rno04090]
 Proteins
  25460 (Hmmr)
Glycosaminoglycan binding proteins [BR:rno00536]
 Hyaluronan
  Cell surface receptors
   25460 (Hmmr)
SSDB
Motif
Pfam: HMMR_N HMMR_C Lebercilin
Other DBs
NCBI-GeneID: 25460
NCBI-ProteinID: NP_037096
RGD: 2805
Ensembl: ENSRNOG00000059894
UniProt: Q9WUF7
Position
10q12
AA seq 713 aa
MSFPKAPLKRFNDPSGCAPSPGAYDVKTSESTKGPVSFQKSQRFKNQRESQQNLNIDKDT
TLLASAKKAKTLVSKKESQKNDKDVKRLEKEIHVLLQERGTQDKRIQDMESELENTEANL
NAPVTEKPSLSANNASLEKRLTELTRANELLKSKFSEDAHQKNMRTLSLELMKLRNKRET
KMRSMMAKQEGMELKLQATQKDLIESKGKIVQLEGKLVSIEKEKIDEKSETEKLLEYIEE
ISCASDQVEKYKLDIAQLEEDLKEKDREILCLKQSLEEKVSFSKQIEDLTVKCQLLEAER
DDLVSKDRERAESLSAEMQVLTEKLLLERQEYEKLQQNELQSQSLLQQEKELSAHLQQQL
CSFQEEMTSERNVFKEQLKLALDELDAVQQKKEQSEKLVKQLEEETKSTAEQLRRLDDLL
REKEIELEKRTAAHAQATVIAQEKYSDTAQTLRDVTAQLESYKSSTLKEIEDLKLENLTL
QEKVAMAEKRVEDVQQQILTAESTNQEYAKVVQDLQNSSTLKEAEIKEITSSYLEKITDL
QNQLRQQNEDFRKQLEEEGAKMTEKETAVTELTMEINKWRLLYEELFDKTKPFQQQLDAF
EAEKQALLNEHGATQEQLSKIRDSYAQLLGHQNLKQKIKHVVKLKDENSQLKSEVSKLRS
QLAKRKQNELRLQGELDKALGIRHFDPSKAFCHESKENVTLKTPLKEGNPNCC
NT seq 2142 nt   +upstreamnt  +downstreamnt
atgtccttccctaaggcgcccctgaaaagattcaatgacccttcgggttgtgctccatct
ccaggtgcttacgatgttaaaacttcagaatcaactaaaggaccagtgtcttttcagaaa
tcacaaagatttaaaaaccaaagagagtctcaacaaaatcttaacattgacaaagatacg
accttgcttgcttctgctaaaaaagcaaagacgttggtgtcaaagaaggagtctcagaag
aatgataaagatgtgaagagattagaaaaagagattcatgttcttttgcaagaacgaggg
actcaggacaaacggatccaggacatggagtctgagttggagaatacagaagccaatcta
aatgcaccagtcacagagaaaccatctctgtctgccaataatgcttcactggaaaaacgg
cttactgagctgaccagagccaacgagctcctaaagtctaagttttctgaagatgctcac
caaaagaatatgagaactctaagcctggaattgatgaaactgagaaataagagagagaca
aagatgaggagcatgatggctaaacaggaaggcatggagctgaagctgcaggccactcag
aaggacctcattgagtctaaggggaaaatagtacagctggagggaaaacttgtttcaata
gagaaagaaaagatcgatgaaaaatctgaaacagaaaaactcttagaatacatagaagaa
attagctgtgcatctgatcaagtggaaaaatacaaactagatattgcccagttagaagaa
gatttgaaagagaaggatcgtgagattttatgccttaagcaatctcttgaggaaaaggtt
tccttttctaagcaaatagaagacctgactgttaaatgtcagctgcttgaagcagaaaga
gatgatctcgtcagcaaggacagagaaagggctgaaagcctcagtgctgagatgcaggtt
ctaacagagaagctgcttctagaaaggcaagaatatgaaaagctgcaacaaaatgaattg
caaagccagtcacttctgcagcaagaaaaggaactgtctgctcatcttcagcagcagctc
tgctcatttcaagaggaaatgacctccgagaggaatgtctttaaagaacagttgaagctt
gccctggatgagctggatgccgtccagcagaaaaaggagcagagtgaaaagctggttaaa
cagctagaagaggaaacgaagtcaactgcggaacagctgaggcggctggatgatctgctg
agagagaaagaaattgaactggagaaaagaaccgctgcacatgcccaggccactgtgatt
gcgcaagagaagtacagtgacacagcgcagactctgagagatgttactgctcagttagaa
agctataagtcatcaacacttaaagaaatagaagatcttaaactggagaatttgactcta
caagaaaaagtagccatggctgagaaaagggtagaagatgttcaacaacaaatattaaca
gctgagagcacaaatcaggaatatgcaaaggtggttcaagatttgcagaacagctcaaca
ttgaaagaagcagaaattaaagaaatcacatcttcatatcttgagaaaataactgatttg
caaaatcaactccgacaacaaaatgaagactttaggaagcagctggaagaggaaggggca
aaaatgacagagaaagaaactgcagtgacagaattaaccatggaaattaataaatggcgt
ctcctatatgaagaactgtttgacaaaactaaaccttttcagcaacaactggatgccttc
gaagcagagaagcaggcactgttgaatgaacatggtgcaactcaggagcagctaagtaaa
atcagagactcctacgcacagctgcttggccaccagaatctgaagcaaaaaatcaaacat
gtcgtgaaattgaaagatgaaaatagccagctcaaatcggaggtgtcaaaactccgatct
cagcttgctaaaaggaaacaaaatgagctcagacttcagggagaattagataaagctctg
ggcatcaggcactttgacccttctaaggctttttgccatgaatctaaggagaatgtgacc
ctcaagactccattgaaagaaggcaacccgaactgctgctga

DBGET integrated database retrieval system