KEGG   Rattus norvegicus (rat): 25461Help
Entry
25461             CDS       T01003                                 

Gene name
Hrh2, H2R
Definition
(RefSeq) histamine receptor H 2
  KO
K04150  histamine receptor H2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04020  Calcium signaling pathway
rno04080  Neuroactive ligand-receptor interaction
rno04971  Gastric acid secretion
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    25461 (Hrh2)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    25461 (Hrh2)
 09150 Organismal Systems
  09154 Digestive system
   04971 Gastric acid secretion
    25461 (Hrh2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    25461 (Hrh2)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Biogenic amine
   Histamine
    25461 (Hrh2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4
Motif
Other DBs
NCBI-GeneID: 25461
NCBI-ProteinID: NP_037097
RGD: 2831
UniProt: P25102
Position
17p14
AA seq 358 aa AA seqDB search
MEPNGTVHSCCLDSMALKVTISVVLTTLILITIAGNVVVCLAVSLNRRLRSLTNCFIVSL
AATDLLLGLLVLPFSAIYQLSFTWSFGHVFCNIYTSLDVMLCTASILNLFMISLDRYCAV
TDPLRYPVLVTPVRVAISLVFIWVISITLSFLSIHLGWNSRNGTRGGNDTFKCKVQVNEV
YGLVDGLVTFYLPLLIMCVTYYRIFKIAREQAKRINHISSWKAATIREHKATVTLAAVMG
AFIICWFPYFTAFVYRGLRGDDAINEAVEGIVLWLGYANSALNPILYAALNRDFRTAYQQ
LFHCKFASHNSHKTSLRLNNSLLPRSQSREGRWQEEKPLKLQVWSGTELTHPQGNPIR
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atggagcccaatggcacagttcattcctgctgcttggactctatggcattgaaagtcacc
atcagtgtggtccttaccacgctcatcctcatcaccattgctggcaatgtggtcgtctgc
ctggctgtcagcttgaaccgtcggctccgcagtctgaccaattgcttcattgtgtccctg
gcagccactgacctgcttcttggactcctggtgctgcccttctctgccatttaccagctg
tccttcacgtggagttttggccacgtcttctgcaacatctacaccagcttggatgtgatg
ctctgcacggcctccatcctcaacctcttcatgatcagcttggaccgctactgcgctgtc
acggacccactgcggtaccctgtgctggtcaccccagttcgagttgccatctctttggtc
tttatttgggttatttctatcaccctatccttcctctctattcacctaggatggaacagc
agaaatgggaccagagggggcaatgacaccttcaagtgcaaagtccaggtcaatgaggtg
tacggactggtggatgggctggtcaccttctacctgcctcttctcatcatgtgtgtcact
tactacagaatctttaagattgccagggagcaggccaaacggatcaaccacatcagctcc
tggaaggcagccaccatcagagagcacaaagccaccgtgacactggcagccgtcatggga
gcgttcatcatctgctggtttccttacttcactgcattcgtttaccgtgggctgagaggg
gatgatgccatcaatgaggcggtcgagggcattgtcctatggttgggctatgccaattca
gccctgaaccccatcctgtacgctgctctcaacagagacttccgcacggcgtaccaacag
ctcttccactgcaagttcgcaagccacaactctcacaaaacttccctgaggttgaacaac
tctctgctgcccaggagccagagccgagaaggtagatggcaggaggagaagcccttgaag
ctccaagtgtggagtgggacagaactcacacacccccagggaaacccaatcaggtaa

DBGET integrated database retrieval system