KEGG   Rattus norvegicus (rat): 25464
Entry
25464             CDS       T01003                                 

Gene name
Icam1
Definition
(RefSeq) intercellular adhesion molecule 1 precursor
  KO
K06490  intercellular adhesion molecule 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04064  NF-kappa B signaling pathway
rno04514  Cell adhesion molecules
rno04650  Natural killer cell mediated cytotoxicity
rno04668  TNF signaling pathway
rno04670  Leukocyte transendothelial migration
rno04933  AGE-RAGE signaling pathway in diabetic complications
rno05143  African trypanosomiasis
rno05144  Malaria
rno05150  Staphylococcus aureus infection
rno05164  Influenza A
rno05166  Human T-cell leukemia virus 1 infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05169  Epstein-Barr virus infection
rno05323  Rheumatoid arthritis
rno05416  Viral myocarditis
rno05417  Lipid and atherosclerosis
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    25464 (Icam1)
   04668 TNF signaling pathway
    25464 (Icam1)
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    25464 (Icam1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    25464 (Icam1)
   04670 Leukocyte transendothelial migration
    25464 (Icam1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    25464 (Icam1)
   05164 Influenza A
    25464 (Icam1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    25464 (Icam1)
   05169 Epstein-Barr virus infection
    25464 (Icam1)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    25464 (Icam1)
  09174 Infectious disease: parasitic
   05144 Malaria
    25464 (Icam1)
   05143 African trypanosomiasis
    25464 (Icam1)
  09163 Immune disease
   05323 Rheumatoid arthritis
    25464 (Icam1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    25464 (Icam1)
   05418 Fluid shear stress and atherosclerosis
    25464 (Icam1)
   05416 Viral myocarditis
    25464 (Icam1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    25464 (Icam1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    25464 (Icam1)
   04090 CD molecules [BR:rno04090]
    25464 (Icam1)
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    25464 (Icam1)
   04091 Lectins [BR:rno04091]
    25464 (Icam1)
Exosome [BR:rno04147]
 Exosomal proteins
  Proteins found in most exosomes
   25464 (Icam1)
CD molecules [BR:rno04090]
 Proteins
  25464 (Icam1)
Glycosaminoglycan binding proteins [BR:rno00536]
 Hyaluronan
  Cell surface receptors
   25464 (Icam1)
Lectins [BR:rno04091]
 I-type lectins (Siglecs)
  25464 (Icam1)
SSDB
Motif
Pfam: ICAM_N Ig_2 Ig_3 C2-set_2 ig tRNA_anti-like
Other DBs
NCBI-GeneID: 25464
NCBI-ProteinID: NP_037099
RGD: 2857
Ensembl: ENSRNOG00000020679
UniProt: Q00238
Position
8
AA seq 545 aa
MASTRARPMLPLLLVLVAVVIPGPVGAQVSIHPTEAFLPRGGSVQVNCSSSCEDENLGLG
LETNWMKDELSSGHNWKLFKLSDIGEDSRPLCFENCGTTQSSASATITVYSFPERVELDP
LPAWQQVGKNLILRCLVEGGAPRTQLSVVLLRGNETLSRQAVDGDPKEITFTVLASRGDH
GANFSCFTELDLRPQGLSLFKNVSEVRQLRTFDLPTRVLKLDTPDLLEVGTQQKFLCSLE
GLFPASEAQIYLEMGGQMLTLESTNSRDFVSATASVEVTEKLDRTLQLRCVLELADQTLE
MEKTLRIYNFSAPILTLSQPEVSEGDQVTVKCEAHGGAQVVLLNSTSPRPPTSQGTSPRP
PTSQIQFTLNASPEDHKRRFFCSAALEVDGKSLFKNQTLELHVLYGPHLDKKDCLGNWTW
QEGSQQTLTCQPQGNPAPNLTCSRKADGVPLPIGMVKSVKREMNGTYKCRAFSSRGSITR
DVHLTVLYHDQNTWVIIVGVLVLIIAGFVIVASIYTYYRQRKIRIYKLQKAQEEALKLKV
QAPPP
NT seq 1638 nt   +upstreamnt  +downstreamnt
atggcttcaacccgtgccaggcccatgctgcctctgctcctggtcctggtcgccgttgtg
atccccgggcctgtcggtgctcaggtatccatccatcccacagaagccttcctgcctcgg
ggtggatccgtgcaggtgaactgctcttcctcttgcgaagacgagaacctcggcctgggg
ttggagactaactggatgaaagacgaactatcgagtggacacaactggaagctcttcaag
ctgagcgacattggggaagacagcagaccactgtgctttgagaactgtggcaccacgcag
tcctcggcttctgccaccatcactgtgtattcgttcccagagcgagtggagctggatcct
ctgcccgcctggcagcaggtgggcaagaacctcatcctgcgctgcctggtggaaggcgga
gcaccgcggacacagctctcagtagtgctgctccgtgggaatgagacactgagccgccag
gcagtggatggggaccccaaggagatcacattcacggtgctggccagcagaggcgaccac
ggagccaatttctcatgcttcacagaactggacctcaggccacaagggctgtcactgttc
aagaatgtctccgaggtcaggcagctccggactttcgatcttccgactagggtcctgaag
ctcgacacccctgacctcctggaggtgggcacccagcagaagttcttgtgttccctggaa
ggcctgtttcctgcctctgaagctcagatatacctggagatgggaggccagatgctgacc
ctggagagcacaaacagcagagattttgtgtcagccactgcctcagtggaggtgactgag
aagttggacagaaccctgcagctgcgctgtgttttggagctggcggaccagaccctggag
atggagaagaccttgagaatctacaacttttcagctcccatcctgaccctgagccagccg
gaggtctcagaaggggaccaagtaactgtgaagtgtgaagcccacggtggggcacaggtg
gtgcttctgaacagtacttcccccaggccacccacctcacagggtacttcccccaggcca
cccacctcacagatccaattcacactgaatgccagcccggaggatcacaaacgacgcttc
ttttgctctgcggccttggaggtggatgggaagtccctgtttaaaaaccagaccttggaa
ctccatgtgctatatggtcctcacctggacaagaaggactgcttggggaactggacctgg
caagaggggtctcagcagactcttacatgccagccccaggggaatccagcccctaatctg
acctgcagccggaaagcagatggtgtcccgctgcctatcgggatggtgaagtctgtcaaa
cgggagatgaatggtacctacaagtgccgtgcctttagctcccgtgggagtatcaccagg
gacgtgcacctgacagtgctgtaccatgatcagaatacctgggtcataattgttggtgtg
ttggtactgatcattgcgggcttcgtgatcgtggcgtccatttacacctattaccgccag
aggaagatcaggatatacaagttacagaaggctcaggaggaggccctaaaactcaaggta
caagccccgcctccctga

DBGET integrated database retrieval system