KEGG   Rattus norvegicus (rat): 25467Help
Entry
25467             CDS       T01003                                 

Gene name
Irs1, IRS1IRM
Definition
(RefSeq) insulin receptor substrate 1
  KO
K16172  insulin receptor substrate 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04022  cGMP-PKG signaling pathway
rno04068  FoxO signaling pathway
rno04140  Autophagy - animal
rno04150  mTOR signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04152  AMPK signaling pathway
rno04211  Longevity regulating pathway
rno04213  Longevity regulating pathway - multiple species
rno04722  Neurotrophin signaling pathway
rno04910  Insulin signaling pathway
rno04920  Adipocytokine signaling pathway
rno04923  Regulation of lipolysis in adipocytes
rno04930  Type II diabetes mellitus
rno04931  Insulin resistance
rno04932  Non-alcoholic fatty liver disease (NAFLD)
rno04960  Aldosterone-regulated sodium reabsorption
rno05206  MicroRNAs in cancer
Module
rno_M00676  PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    25467 (Irs1)
   04022 cGMP - PKG signaling pathway
    25467 (Irs1)
   04151 PI3K-Akt signaling pathway
    25467 (Irs1)
   04152 AMPK signaling pathway
    25467 (Irs1)
   04150 mTOR signaling pathway
    25467 (Irs1)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    25467 (Irs1)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    25467 (Irs1)
   04923 Regulation of lipolysis in adipocyte
    25467 (Irs1)
   04920 Adipocytokine signaling pathway
    25467 (Irs1)
  Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    25467 (Irs1)
  Nervous system
   04722 Neurotrophin signaling pathway
    25467 (Irs1)
  Aging
   04211 Longevity regulating pathway - mammal
    25467 (Irs1)
   04213 Longevity regulating pathway - multiple species
    25467 (Irs1)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    25467 (Irs1)
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    25467 (Irs1)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    25467 (Irs1)
   04931 Insulin resistance
    25467 (Irs1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IRS PH PH_11
Motif
Other DBs
NCBI-GeneID: 25467
NCBI-ProteinID: NP_037101
RGD: 2922
Ensembl: ENSRNOG00000014597
UniProt: P35570
Position
9q34
AA seq 1235 aa AA seqDB search
MASPPDTDGFSDVRKVGYLRKPKSMHKRFFVLRAASEAGGPARLEYYENEKKWRHKSSAP
KRSIPLESCFNINKRADSKNKHLVALYTRDEHFAIAADSEAEQDSWYQALLQLHNRAKAH
HDGAGGGCGGSCSGSSGVGEAGEDLSYDTGPGPAFKEVWQVILKPKGLGQTKNLIGIYRL
CLTSKTISFVKLNSEAAAVVLQLMNIRRCGHSENFFFIEVGRSAVTGPGEFWMQVDDSVV
AQNMHETILEAMRAMSDEFRPRTKSQSSSSCSNPISVPLRRHHLNNPPPSQVGLTRRSRT
ESITATSPASMVGGKPGSFRVRASSDGEGTMSRPASVDGSPVSPSTNRTHAHRHRGSSRL
HPPLNHSRSIPMPSSRCSPSATSPVSLSSSSTSGHGSTSDCLFPRRSSASVSGSPSDGGF
ISSDEYGSSPCDFRSSFRSVTPDSLGHTPPARGEEELSNYICMGGKGASTLTAPNGHYIL
SRGGNGHRYIPGATMGTSPALTGDEAAGAADLDNRFRKRTHSAGTSPTISHQKTPSQSSV
VSIEEYTEMMPAAYPPGGGSGGRLPGYRHSAFVPTHSYPEEGLEMHHLERRGGHHRPDSS
NLHTDDGYMPMSPGVAPVPSNRKGNGDYMPMSPKSVSAPQQIINPIRRHPQRVDPNGYMM
MSPSGSCSPDIGGGSCSSSSISAAPSGSSYGKPWTNGVGGHHTHALPHAKPPVESGGGKL
LPCTGDYMNMSPVGDSNTSSPSECYYGPEDPQHKPVLSYYSLPRSFKHTQRPGEPEEGAR
HQHLRLSSSSGRLRYTATAEDSSSSTSSDSLGGGYCGARPESSVTHPHHHALQPHLPRKV
DTAAQTNSRLARPTRLSLGDPKASTLPRVREQQQQQQQQQQSSLHPPEPKSPGEYVNIEF
GSGQPGYLAGPATSRSSPSVRCLPQLHPAPREETGSEEYMNMDLGPGRRATWQESGGVEL
GRVGPAPPGAASICRPTRSVPNSRGDYMTMQIGCPRQSYVDTSPVAPVSYADMRTGIAAE
KVSLPRTTGAAPPPSSTASASASVTPQGAAEQAAHSSLLGGPQGPGGMSAFTRVNLSPNH
NQSAKVIRADTQGCRRRHSSETFSAPTRAANTVSFGAGAAGGGSGGGSEDVKRHSSASFE
NVWLRPGDLGGASKESAPGCGAAGGLEKSLNYIDLDLVKDVKQHPQDCPSQQQSLPPPPP
HQPLGSNEGSSPRRSSEDLSTYASINFQKQPEDRQ
NT seq 3708 nt NT seq  +upstreamnt  +downstreamnt
atggcgagccctccggataccgatggcttctcagacgtgcgcaaggtgggttacctgcgc
aaacccaagagtatgcataagcgctttttcgtgctgcgggcggccagcgaggccgggggc
ccggcgcgcctggagtattatgagaacgagaagaagtggcggcacaagtcgagcgccccc
aaacgctcgatccccctcgagagctgtttcaacatcaacaagcgggctgactccaagaac
aagcacctggtggctctctacacccgagacgaacactttgccattgcggcggatagcgag
gctgaacaagacagctggtaccaggctcttctgcagctgcataatcgggcaaaggcccac
catgacggggctggaggaggctgcggtggtagctgcagcggcagctctggcgtcggagag
gcaggggaggacttgagctatgacacgggcccaggacccgcgttcaaggaggtctggcag
gttatcctgaaacccaagggcttaggtcagacaaagaacttgattggtatctaccgcctc
tgcctgaccagcaagaccatcagctttgtgaagctcaactctgaggctgccgctgtggtg
ctgcagctgatgaacatcagacgctgtggccactcagagaacttcttcttcatcgaggtg
gggcggtcagctgtgaccgggcccggcgagttctggatgcaagtggatgactccgtggtg
gcccagaacatgcatgagaccattctagaggccatgcgggccatgagcgatgagtttcgc
ccgcgcacgaaaagccaatcttcatccagttgctccaaccccatcagtgttcccctgcgc
aggcaccatctcaacaatcctccgcccagccaagtggggctgactcggagatctcgaact
gagagcatcactgccacctcccctgccagtatggtgggtgggaaaccaggttccttcagg
gtgcgtgcctccagcgatggcgaaggcaccatgtcccgtccagcatcagtggatggcagt
cctgtgagccctagcaccaacaggacccacgcccatcggcatcgaggcagctccaggttg
caccccccactcaaccacagccgctccatccctatgccttcttcacgatgctccccttca
gccaccagcccagtgagcctgtcatccagtagtaccagtggccacggctccacttcagac
tgtctcttcccgaggcgctctagtgcttccgtgtccggttctcctagcgatggcggtttc
atctcttctgatgagtatggctctagtccctgcgatttccgaagttccttccgcagtgtc
accccagattccctgggccacaccccaccagccaggggtgaggaggagctgagcaactat
atctgcatgggtggcaagggagcctccaccttgacagctcccaatggtcactacattttg
tctaggggtggcaacggccatcgctacatcccaggtgctaccatggggacaagcccggcg
ctgactggagacgaagccgctggtgcagcagatctggataaccggtttcggaagagaact
cactcggctggcacgtcccccaccatatcccaccagaagaccccctcgcagtcctcagtg
gtttctattgaggaatatacagagatgatgcccgctgcctacccaccaggaggtggcagt
ggaggccgactgcccggctaccggcattccgccttcgtgcccacccactcctatcccgag
gagggtctagagatgcaccacttggaacgtcgtgggggccaccaccgtccagactcctcc
aacctccacaccgatgatggctacatgcccatgtctcccggagtggctccagtgcccagc
aaccgcaaaggaaatggggactatatgcccatgagccccaagagtgtatctgccccccag
cagatcattaaccccatcaggcgccacccacagagagtggaccccaatggctacatgatg
atgtctcccagtggtagttgctctcctgacattggaggtgggtcttgcagcagtagcagc
atcagcgcagccccttctgggagcagctatgggaagccatggacaaacggagtagggggg
caccatacccatgcccttccccatgccaaacctcctgttgagagcggtggtggtaagctc
ttgccttgcactggtgactacatgaacatgtcgccagtgggagattccaacaccagcagc
ccctcagaatgctactatggcccagaagatccccagcacaagcctgtcctctcctactac
tcattaccaaggtcctttaagcacacccagcgccctggggagccagaggagggtgccagg
caccagcatcttcgtctctcttcaagctctggacgccttcgctataccgcaactgccgaa
gattcctcctcttccaccagcagcgacagcctgggtgggggttactgtggggctaggcca
gagtctagcgtcacacatccccaccaccatgccttgcagccccatctgcctcgaaaggta
gacacagctgcacagaccaacagccgcctggctcgacccacaaggctgtccttgggggat
cccaaggcaagcactttaccccgggtacgagagcaacagcagcagcagcaacagcagcag
cagtcttccctgcaccctcccgagcccaaaagcccaggagaatatgtgaatattgaattc
gggagtggccagccaggctatttagctggccctgcaacttcccgtagctccccttcagtt
cgatgtctaccccagctccacccagctcccagagaagagactggctcggaagagtacatg
aacatggacttggggccaggccggagggcaacctggcaggagagtggtggagttgagttg
ggcagagtaggccctgcacctccaggggctgcttccatttgtaggccaacccggtcggtg
ccaaatagccgtggtgattacatgaccatgcagataggttgtcctcgtcaaagctatgtg
gatacctcaccagtggccccagtcagctatgctgacatgcggacaggcattgctgcagag
aaggtgagcctgcccagaaccacaggagctgccccccctccatcctccacagcctctgct
tctgcttctgttacacctcaaggggccgctgagcaggccgctcactcttccttgctggga
ggccctcagggacctgggggcatgagcgcattcaccagggtgaacctaagtcccaaccat
aaccagagtgccaaagtgattcgtgcagacactcaaggctgccggaggaggcacagctcc
gagaccttctcggcgcctacgcgggctgccaacacagtgtcttttggagcaggggctgca
ggagggggcagcggtggtggcagtgaggatgtgaaacgccacagctctgcatcctttgag
aatgtgtggctgagacccggggatctagggggagcatccaaggagtcggctccagggtgc
ggggctgccgggggattggagaagagtcttaactatatagacttggatttggtcaaggat
gttaagcagcaccctcaagactgcccctctcaacagcagtccctgccaccccctccccct
caccaacccttaggcagcaatgagggcagctccccaagacgctccagtgaggatttaagc
acctatgccagcatcaacttccagaagcaaccagaggaccgtcaatag

DBGET integrated database retrieval system