KEGG   Rattus norvegicus (rat): 25468Help
Entry
25468             CDS       T01003                                 

Gene name
Kcna2, BK2, NGK1
Definition
(RefSeq) potassium voltage-gated channel subfamily A member 2
  KO
K04875  potassium voltage-gated channel Shaker-related subfamily A member 2
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    25468 (Kcna2)
Ion channels [BR:rno04040]
 Voltage-gated cation channels
  Potassium channel, voltage-gated (Kv)
   25468 (Kcna2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans BTB_2 Ion_trans_2 PKD_channel
Motif
Other DBs
NCBI-GeneID: 25468
NCBI-ProteinID: NP_037102
RGD: 2950
Ensembl: ENSRNOG00000018285
Vega: OTTRNOG00000001898
UniProt: P63142
Structure
PDB: 

Position
2q34
AA seq 499 aa AA seqDB search
MTVATGDPVDEAAALPGHPQDTYDPEADHECCERVVINISGLRFETQLKTLAQFPETLLG
DPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDIFSEEIRFYELGE
EAMEMFREDEGYIKEEERPLPENEFQRQVWLLFEYPESSGPARIIAIVSVMVILISIVSF
CLETLPIFRDENEDMHGGGVTFHTYSNSTIGYQQSTSFTDPFFIVETLCIIWFSFEFLVR
FFACPSKAGFFTNIMNIIDIVAIIPYFITLGTELAEKPEDAQQGQQAMSLAILRVIRLVR
VFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADERDSQFPS
IPDAFWWAVVSMTTVGYGDMVPTTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRE
TEGEEQAQYLQVTSCPKIPSSPDLKKSRSASTISKSDYMEIQEGVNNSNEDFREENLKTA
NCTLANTNYVNITKMLTDV
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgacagtggctaccggagacccagtggatgaggctgctgccctccctgggcaccctcaa
gacacctatgacccagaggcagaccacgagtgctgtgagagagtggtgattaacatctca
ggcctgcggttcgagactcagctaaagaccttagcccagttcccagagaccctcttagga
gaccccaagaaacggatgaggtactttgatcccctccgaaatgagtacttttttgatcgc
aaccgccctagctttgatgccattttgtactactaccagtctgggggcaggttgaggcga
cctgtgaatgtgcccttagatatcttctctgaagaaatccggttttatgagctaggagaa
gaggcaatggagatgtttcgggaggatgaaggctatatcaaggaagaagaacgtcccctg
cctgaaaatgagtttcagagacaggtgtggcttctctttgaataccctgagagctcaggg
ccggccaggatcatagccattgtatctgtgatggtcattctgatctcgatcgtcagcttc
tgtctggaaaccttgcccatcttccgggatgagaacgaggacatgcatggtggtggggtg
accttccacacctattccaacagcaccattgggtaccagcagtccacctccttcaccgac
cctttcttcatcgtagagactctctgcatcatctggttctcctttgagtttctggttaga
ttctttgcctgtcccagcaaagctggcttcttcaccaacatcatgaacatcattgacatt
gtggctatcatcccttactttatcaccctggggacagagttagctgagaagccagaggac
gcccagcaaggccagcaggccatgtcactggccattctccgtgtcatccggttggtaaga
gtctttaggattttcaagttgtccagacactccaaaggtctgcagattctaggtcagacc
ctcaaagccagcatgagggaattgggcctcctgatattcttcctcttcattggggtcatc
ctcttctctagtgctgtctattttgcagaagctgatgagcgagattcccagttccccagc
atcccggatgccttctggtgggcagtcgtctccatgacaactgtaggctatggagacatg
gttccaactaccattgggggaaagatagtgggttctctgtgtgcaattgcaggtgtgtta
accattgccttaccagtccctgtcatagtgtctaatttcaactacttctaccaccgggag
acagagggagaggagcaggcccagtacttgcaagtgacaagttgtccaaagatcccgtcc
tcccctgacctaaagaaaagtagaagtgcctctaccataagtaagtctgattacatggag
atacaggagggagtaaacaacagtaatgaggactttagagaggagaacttaaaaacagcc
aactgtaccttggctaacacaaactatgtgaatattaccaaaatgttaactgatgtctga

DBGET integrated database retrieval system