KEGG   Rattus norvegicus (rat): 25473Help
Entry
25473             CDS       T01003                                 

Gene name
Lamb2, SLAM
Definition
(RefSeq) laminin subunit beta 2
  KO
K06243  laminin, beta 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04151  PI3K-Akt signaling pathway
rno04510  Focal adhesion
rno04512  ECM-receptor interaction
rno05145  Toxoplasmosis
rno05146  Amoebiasis
rno05165  Human papillomavirus infection
rno05200  Pathways in cancer
rno05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    25473 (Lamb2)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    25473 (Lamb2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    25473 (Lamb2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    25473 (Lamb2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    25473 (Lamb2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    25473 (Lamb2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    25473 (Lamb2)
   05145 Toxoplasmosis
    25473 (Lamb2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Laminin_EGF Laminin_N F5_F8_type_C
Motif
Other DBs
NCBI-GeneID: 25473
NCBI-ProteinID: NP_037106
RGD: 2988
Ensembl: ENSRNOG00000047768
UniProt: P15800
Structure
PDB: 

Position
8q32
AA seq 1801 aa AA seqDB search
MEWASGKPGRGRQGQPVPWELRLGLLLSVLAATLAQVPSLDVPGCSRGSCYPATGDLLVG
RADRLTASSTCGLHSPQPYCIVSHLQDEKKCFLCDSRRPFSARDNPNSHRIQNVVTSFAP
QRRTAWWQSENGVPMVTIQLDLEAEFHFTHLIMTFKTFRPAAMLVERSADFGRTWRVYRY
FSYDCGADFPGIPLAPPRRWDDVVCESRYSEIEPSTEGEVIYRVLDPAIPIPDPYSSRIQ
NLLKITNLRVNLTRLHTLGDNLLDPRREIREKYYYALYELVIRGNCFCYGHASQCAPAPG
APAHAEGMVHGACICKHNTRGLNCEQCQDFYQDLPWHPAEDGHTHACRKCECNGHSHSCH
FDMAVYLASGNVSGGVCDGCQHNTAGRHCELCRPFFYRDPTKDMRDPAACRPCDCDPMGS
QDGGRCDSHDDPVLGLVSGQCRCKEHVVGTRCQQCRDGFFGLSASNPRGCQRCQCNSRGT
VPGGTPCDSSSGTCFCKRLVTGDGCDRCLPGHWGLSHDLLGCRPCDCDVGGALDPQCDEA
TGQCPCRPHMIGRRCEQVQPGYFRPFLDHLTWEAEGAHGQVLEVVERLVTNRETPSWTGV
GFVRLREGQEVEFLVTSLPRAMDYDLLLRWEPQVPEQWAELELVVQRPGPVSAHSPCGHV
LPRDDRIQGMLHPNTRVLVFPRPVCLEPGLSYKLKLKLTGTGGRAHPETPYSGSGILIDS
LVLQPHVLMLEMFSGGDAAALERRTTFERYRCHEEGLMPSKTPLSEACVPLLISASSLVY
NGALPCQCDPQGSLSSECNPHGGQCRCKPGVVGRRCDACATGYYGFGPAGCQACQCSPDG
ALSALCEGTSGQCLCRTGAFGLRCDHCQRGQWGFPNCRPCVCNGRADECDAHTGACLGCR
DYTGGEHCERCIAGFHGDPRLPYGGQCRPCPCPEGPGSQRHFATSCHRDGYSQQIVCHCR
AGYTGLRCEACAPGHFGDPSKPGGRCQLCECSGNIDPTDPGACDPHTGQCLRCLHHTEGP
HCGHCKPGFHGQAARQSCHRCTCNLLGTDPQRCPSTDLCHCDPSTGQCPCLPHVQGLSCD
RCAPNFWNFTSGRGCQPCACHPSRARGPTCNEFTGQCHCHAGFGGRTCSECQELHWGDPG
LQCRACDCDPRGIDKPQCHRSTGHCSCRPGVSGVRCDQCARGFSGVFPACHPCHACFGDW
DRVVQDLAARTRRLEQWAQELQQTGVLGAFESSFLNLQGKLGMVQAIVAARNTSAASTAK
LVEATEGLRHEIGKTTERLTQLEAELTDVQDENFNANHALSGLERDGLALNLTLRQLDQH
LDILKHSNFLGAYDSIRHAHSQSTEAERRANASTFAIPSPVSNSADTRRRAEVLMGAQRE
NFNRQHLANQQALGRLSTHTHTLSLTGVNELVCGAPGDAPCATSPCGGAGCRDEDGQPRC
GGLGCSGAAATADLALGRARHTQAELQRALVEGGGILSRVSETRRQAEEAQQRAQAALDK
ANASRGQVEQANQELRELIQNVKDFLSQEGADPDSIEMVATRVLDISIPASPEQIQRLAS
EIAERVRSLADVDTILAHTMGDVRRAEQLLQDAQRARSRAEGERQKAETVQAALEEAQRA
QGAAQGAIRGAVVDTKNTEQTLQQVQERMAGTEQSLNSASERARQLHALLEALKLKRAGN
SLAASTAEETAGSAQSRAREAEKQLREQVGDQYQTVRALAERKAEGVLAAQARAEQLRDE
ARGLLQAAQDKLQRLQELEGTYEENERELEVKAAQLDGLEARMRSVLQAINLQVQIYNTC
Q
NT seq 5406 nt NT seq  +upstreamnt  +downstreamnt
atggagtgggcctcaggaaaaccagggaggggcaggcagggacagcctgtgccatgggaa
cttcgcttgggcctacttctaagtgtgctggctgccacattggcccaagtcccatccttg
gatgtacctggctgttctcgaggaagctgctatccagccaccggtgacctgttggtgggc
cgtgcagacagactgacagcctcctccacgtgtggcttgcatagccctcaaccctactgt
attgtcagtcacctgcaggatgaaaagaagtgcttcctgtgtgactcccgacgtcccttc
tctgctcgagacaacccaaatagtcaccggatccagaatgtagtcactagctttgcgcca
caacgccggacggcctggtggcagtcggagaacggtgttccgatggtcaccatccaactg
gacctggaagctgagtttcatttcacccacctcatcatgaccttcaagacatttcgtcct
gcggccatgctggtggagcgctctgcagacttcggccgcacgtggcgtgtctaccgatat
ttttcctacgactgcggggctgacttcccaggaatcccgctggccccgccgcgtcgctgg
gatgatgtagtgtgtgagtcccgctactcagaaattgagccatctactgaaggcgaggtc
atctatcgtgtgctggatcctgctattcctattccagacccctacagctcacggattcag
aacctgttgaagatcaccaacctccgtgtgaacctcacccggcttcacacactgggagac
aacttgcttgacccacggcgggagatccgggaaaaatattattatgctctctatgaactt
gtcatccgcgggaactgcttctgctatggacatgcctcacagtgtgcgcctgcaccaggg
gcaccggcccatgctgagggcatggtacatggggcctgtatttgcaagcacaatactcgt
gggctcaactgtgagcagtgtcaggatttctatcaggaccttccctggcatcctgctgag
gatggccatactcacgcctgtcggaagtgtgagtgcaacgggcatagtcatagctgccac
tttgacatggctgtgtacctggcatctggaaacgtaagtggaggtgtctgcgatggctgt
cagcacaacacggctgggcgccactgcgagctctgccggcccttcttctaccgtgaccca
accaaggacatgcgggatccagctgcgtgccgtccttgtgactgtgacccaatgggttct
caagacggtggccgctgtgattcccatgatgaccctgtgctaggtctggtctcaggccag
tgtcgctgcaaagaacacgtggttggcactcgctgccagcaatgccgggacggcttcttt
ggacttagtgccagcaaccctcgaggatgtcagcgttgtcagtgtaactcaaggggcaca
gtgcctgggggcaccccttgtgactccagtagtggaacctgtttctgcaagcgtctggtg
actggagacggctgtgaccgctgtctgcctggccactggggcctgagccatgacctgcta
ggctgccgcccctgtgactgtgatgtgggcggtgccttggatcctcagtgtgatgaagcc
acgggtcagtgcccgtgccgcccacacatgattgggcggcgctgtgaacaagtacagcct
ggctacttccggccttttctagaccatctaacctgggaggctgagggtgcccatgggcag
gtgcttgaggtggtagaacgtctggtgaccaaccgagagactccgtcctggactggtgta
ggctttgtgcgactgcgggaaggtcaggaagtggagttcctggtgacctctttgcctagg
gccatggactatgacctgctactgcgctgggagccccaggttcctgagcagtgggcagag
ctggaattggtggtgcagcgcccagggcctgtgtctgcacacagtccgtgtgggcacgtg
ctgccgagggatgaccgcattcaggggatgcttcacccaaacaccagggttttggtgttt
cccagacctgtctgccttgagcctggtctctcctacaagctgaagttgaaattgactgga
acagggggacgtgcccatcctgaaaccccatactctggatctggaatactcattgactcg
ctggtgctgcagccccatgtcttgatgctagagatgtttagtgggggggatgctgctgcc
ctggaacgccgtaccacctttgaacgctaccgctgccatgaggaaggtctgatgcccagc
aagacccccctatctgaggcctgcgttcccctcctcatcagtgcgtcctccctggtctac
aatggcgccttgccctgccagtgtgaccctcaaggctcactgagttccgaatgcaatcct
catggtggccagtgccggtgcaagcctggagtggttggacgacgctgtgatgcctgtgct
actggctactatggctttgggcccgcaggctgtcaagcctgccagtgtagtcccgacgga
gcactcagtgccctgtgtgaagggactagtggacagtgtctctgccgaaccggtgccttt
ggtcttcgctgtgaccactgtcaacgtggccagtggggtttccctaactgccggccgtgt
gtctgcaacgggcgtgcagatgagtgtgacgcccacacaggcgcttgcctgggctgccgt
gattacacagggggcgagcactgtgagaggtgcattgctggttttcatggggacccacgg
ctgccatatgggggccagtgccggccttgtccctgccctgaaggccccgggagccagcga
cactttgctacttcatgtcaccgggatggatattcccagcaaattgtgtgccactgtcga
gcaggctacacagggcttcggtgtgaggcttgtgcccccgggcactttggggacccatcc
aagccaggtggcaggtgccaactgtgtgagtgcagtgggaacattgaccccacggatccc
ggtgcctgtgatccccacacggggcaatgcttgcgctgtttacaccacacggaggggccc
cactgtggccattgcaagcctggcttccatgggcaagctgcccgacagagctgtcaccgc
tgtacctgcaaccttctgggcacagatccccagcggtgcccatctacagacctgtgccat
tgtgacccaagcactgggcagtgcccatgcctcccccatgtccaaggcctcagttgcgac
cgttgtgcccccaacttttggaactttaccagtggacgtggctgccagccttgtgcttgt
cacccaagccgggccagaggccctacctgcaatgagttcacagggcagtgccactgtcat
gctggctttggtgggaggacctgttctgagtgccaagagctccactggggagaccctgga
ctgcagtgccgcgcctgtgactgtgatcccagaggaatagacaaaccccaatgtcatcgt
tctactggtcactgtagctgccgcccaggcgtgtctggcgtgcgctgcgaccagtgtgct
cgtggcttctcgggtgtttttcctgcttgtcacccctgccatgcatgctttggagactgg
gatcgtgtggtacaggaccttgctgctcgtacgcggcgcctggagcagtgggctcaggaa
ttgcagcaaacgggtgtgctgggtgcctttgagagcagctttttaaacctgcaggggaag
ctgggaatggtgcaggccatcgtggctgcccgcaacacctcagctgcgtctactgcaaag
cttgtagaggccacagagggactgcgtcatgaaattgggaagaccactgaacgcctgact
cagttagaagcagagctcacagatgtacaggatgagaacttcaatgccaaccatgcactc
agtggtctggagagagacgggctcgcacttaatctcacactgaggcagcttgaccagcat
ctggatatcctcaaacactcaaatttcttaggtgcctatgacagcatccgacatgcccac
agtcagtctacagaagcagagcgccgggccaatgcctccacctttgcaatacccagccct
gtgagcaactcagcagatacccggcgtcgggcagaagtgctaatgggtgcccaaagagag
aacttcaaccgccagcacttggccaaccagcaggcacttggacggctgtccacacacacc
cataccctgagcctgacgggagtaaatgagctggtgtgtggggccccaggggacgcaccc
tgtgctaccagcccttgtgggggtgctggatgtcgggatgaggatgggcaaccccgctgt
ggtggcctcggttgcagtggagcagcagccacagcagatctagcactgggccgggctcgg
cacacacaggcagagctgcagagagcgctggtagaaggtggtggcatcctcagccgagtg
tctgagactcgtcggcaggcagaggaggcccagcaacgagcacaggcagccctggacaag
gctaatgcttctaggggccaagtggagcaggccaatcaggagcttcgagaacttatccag
aatgtgaaggacttcctcagccaggagggagctgatcccgacagtattgaaatggtagca
acacgggtgctagacatctccatcccagcctcgcctgagcagatccagcgcctagcaagt
gagattgcagaacgtgtccgaagcctggcggatgtggacacaatcctggcacataccatg
ggggatgtgcgtcgggctgaacagctactgcaagatgcacagcgggcacggagccgggct
gagggtgagagacagaaggcagagacagtccaagcggcactggaggaggcccagagggca
cagggagctgctcagggcgccatccggggagcagtggttgacacaaaaaacacagagcag
accctgcagcaggtccaggagaggatggcaggtacagagcagtctctgaactctgctagt
gagcgggctcggcagttacatgcccttctggaagccctgaaactgaaaagggcaggaaac
agcctggcagcatctacagctgaagagacagcaggcagtgcccagagccgtgccagggag
gctgagaaacagctacgggaacaagtaggtgaccagtaccaaactgtgagggcgttggct
gaacggaaggctgaaggtgttctggccgcacaagccagagcagaacaactgcgggatgag
gctcggggtctgttgcaggctgctcaggacaagttgcagcggctacaggaactggagggc
acatatgaagagaatgaacgcgaactggaggtcaaagcggctcagctggatgggctggag
gccaggatgcgcagtgtgcttcaggcaatcaacctgcaggtccagatctacaacacctgc
cagtga

DBGET integrated database retrieval system