KEGG   Rattus norvegicus (rat): 25474
Entry
25474             CDS       T01003                                 

Gene name
Lgals4
Definition
(RefSeq) galectin-4
  KO
K10091  galectin-4
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04091 Lectins [BR:rno04091]
    25474 (Lgals4)
Lectins [BR:rno04091]
 S-type lectins (Galectins)
  25474 (Lgals4)
SSDB
Motif
Pfam: Gal-bind_lectin
Other DBs
NCBI-GeneID: 25474
NCBI-ProteinID: NP_037107
RGD: 3003
Ensembl: ENSRNOG00000020338
UniProt: P38552
Position
1
AA seq 324 aa
MAYVPAPGYQPTYNPTLPYKRPIPGGLSVGMSIYIQGIAKDNMRRFHVNFAVGQDEGADI
AFHFNPRFDGWDKVVFNTMQSGQWGKEEKKKSMPFQKGHHFELVFMVMSEHYKVVVNGTP
FYEYGHRLPLQMVTHLQVDGDLELQSINFLGGQPAASQYPGTMTIPAYPSAGYNPPQMNS
LPVMAGPPIFNPPVPYVGTLQGGLTARRTIIIKGYVLPTAKNLIINFKVGSTGDIAFHMN
PRIGDCVVRNSYMNGSWGSEERKIPYNPFGAGQFFDLSIRCGTDRFKVFANGQHLFDFSH
RFQAFQRVDMLEIKGDITLSYVQI
NT seq 975 nt   +upstreamnt  +downstreamnt
atggcctatgtcccagcacccggctaccagcccacctacaatccgacgctgccctacaag
aggcccatcccaggtggcctcagtgtcggaatgtccatttacatccaaggaatagccaaa
gacaacatgagacggttccacgtgaactttgctgtggggcaggatgagggggcagatatt
gctttccacttcaacccccggtttgatggctgggacaaggtggtcttcaatacgatgcaa
agcggacagtggggcaaggaagagaagaagaagagcatgcctttccaaaagggtcaccac
ttcgagctggtgttcatggtcatgtctgagcactacaaggtcgtggtaaacggaactccc
ttctacgaatatgggcaccggttgcccctacagatggtcacccacttgcaagtggatggg
gacctggaacttcagtcaatcaacttccttgggggccaacctgctgcatcccagtatccg
ggaaccatgactattccagcttatcctagtgctgggtacaaccctccacagatgaacagc
ctgcctgtcatggcgggacccccgatcttcaatccgcctgtgccatatgtggggaccctg
caggggggccttacagcccgaagaaccatcataatcaagggatatgtacttcctacagcc
aagaaccttatcatcaacttcaaggtggggtcgaccggagacatagcttttcacatgaac
ccccgcataggtgattgtgtggttcgcaacagctatatgaatggctcttggggctccgaa
gagaggaagataccctacaacccgtttggcgctgggcagttctttgatctgtcaatccgc
tgcggcacggatcgattcaaggtgtttgccaacggccagcaccttttcgacttctcacat
cggttccaagcattccaaagggtagacatgctggagatcaaaggcgacatcaccttgtcc
tatgtccagatctga

DBGET integrated database retrieval system