KEGG   Rattus norvegicus (rat): 25478
Entry
25478             CDS       T01003                                 

Gene name
Man2a1, Mana2, Manno
Definition
(RefSeq) mannosidase, alpha, class 2A, member 1
  KO
K01231  alpha-mannosidase II [EC:3.2.1.114]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00510  N-Glycan biosynthesis
rno00513  Various types of N-glycan biosynthesis
rno01100  Metabolic pathways
Module
rno_M00075  N-glycan biosynthesis, complex type
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    25478 (Man2a1)
   00513 Various types of N-glycan biosynthesis
    25478 (Man2a1)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.114  mannosyl-oligosaccharide 1,3-1,6-alpha-mannosidase
     25478 (Man2a1)
SSDB
Motif
Pfam: Glyco_hydro_38N Glyco_hydro_38C Alpha-mann_mid Glyco_hydro_57 RnlA-toxin_C
Other DBs
NCBI-GeneID: 25478
NCBI-ProteinID: NP_037111
RGD: 3038
Ensembl: ENSRNOG00000015439
UniProt: P28494
Position
9q37
AA seq 1148 aa
MKLSRQFTVFGSAIFCVVIFSLYLMLDRGHLDYPRGPRQEGSFPQGQLSILQEKIDHLER
LLAENNEIISNIRDSVINLSESVEDGPRGPAGNASQGSAHLHSAQLALQADPKDCLFASQ
SGNQHRDVQMLDVYDLIPFDNPDGGVWKQGFDIKYEADEWDREPLQVFVVPHSHNDPGWL
KTFNDYFRDKTQYIFNNMVLKLKEDSSRKFIWSEISYLAKWWDIIDNPKKEAVKSLLQNG
QLEIVTGGWVMADEATTHYFALIDQLIEGHQWLEKNLGVKPRSGWAIDPFGHSPTMTYLL
KRAGFSHMLIQRVHYSVKKHFSLQKTLEFFWRQNWDLGSTTDILCHMMPFYSYDIPHTCG
PDPKICCQFDFKRLPGGRYGCPWGVPPEAISPGNVQSRAQMLLDQYRKKSKLFRTKVLLA
PLGDDFRFSEYTEWDLQYRNYEQLFSYMNSQPHLKVKIQFGTLSDYFDALEKSVAAEKKG
GQSVFPALSGDFFTYADRDDHYWSGYFTSRPFYKRMDRIMESRLRTAEILYHLALKQAQK
YKINKFLSSPHYTTLTEARRNLGLFQHHDAITGTAKDWVVVDYGTRLFQSLNSLEKIIGD
SAFLLILKDKKLYQSDPSKAFLEMDTKQSSQDSLPKKNIIQLSAQEPRYLVVYNPFEQER
HSVVSVRVNSATVKVLSDLGKAVEVQVSAVWKDMRTTSQAAYEVAFLAHLPPLGLKVYKI
LESQSSSSHLADYFLYNNDGQAESGIFHMKNMVDSGDAITIENSFLTLGFDRSGLMEKVR
RKEDNKQQELKVQFLWYGTTNKRDKSGAYLFLPDGQGQPYVSLRTPFVRVTRGRIYSDVT
CFLEHVTHKVRLYHIQGIEGQSMEVSNIVDIRSVHNREIVMRISSKINNQNRYYTDLNGY
QIQPRRTMAKLPLQANVYPMSTMAYIQDAAHRLTLLSAQSLGASSMASGQIEVFMDRRLM
QDDNRGLGQGVHDNKITANLFRILLEKRNGMNMEEDKKSPVSYPSLLSHMTSAFLNHPFL
PMVLSGQLPSPAIELLSEFRLLQSSLPCDIHLVNLRTIQSKVGKGYSDEAALILHRKVFD
CQLSSRAMGLPCSTTQGKMSIPKLFNNFAVESFIPSSLSLMHSPPDAQNTSEVSLSPMEI
STSRIRLR
NT seq 3447 nt   +upstreamnt  +downstreamnt
atgaagttaagccgccagttcaccgtgttcggcagcgcgatcttctgcgtcgtaatcttc
tcactctacctgatgctggacaggggtcacttggactaccctcggggcccgcgccaggag
ggctccttcccgcagggccagctttcaatattgcaagaaaagatcgaccatttggagcgt
ttgctagcggagaacaacgagatcatctcgaatatcagagactcggtcatcaacctgagt
gagtctgtggaagatggcccacgaggtccagcaggcaacgccagccaaggctctgcgcac
ctccactctgcacagttggccctacaggctgaccccaaagactgcttgtttgcctcgcag
agcggaaaccagcaccgggatgtgcagatgttggatgtttacgatctgattccttttgat
aatccagatggtggagtttggaagcaagggtttgacattaagtacgaagctgatgagtgg
gaccgtgagcccctgcaagtgtttgtggtgcctcactcccataatgacccaggttggttg
aagactttcaatgactactttagagacaagactcagtatatttttaataacatggtccta
aagctgaaagaagactcaagcaggaagtttatatggtctgagatctcttaccttgcaaaa
tggtgggatattatagataatccgaagaaggaagctgttaaaagtttactacagaatggt
cagcttgagattgtgaccggtggctgggtgatggccgatgaagccactacacattatttt
gccttaattgaccaactgattgaagggcatcaatggctggaaaaaaatctaggagtgaaa
cctcgatcgggctgggccatagatccctttggacattcacccacaatgacttaccttcta
aaacgtgctggattttcacacatgctcatccagagagtccattattcggtgaaaaaacac
ttctctttgcaaaaaacgctggaatttttctggagacagaattgggatcttggatccacc
acagacattttgtgccacatgatgcccttctatagctatgacatcccccacacctgtgga
cccgatcccaaaatatgctgccagtttgattttaagcggcttcctggaggcagatacggt
tgtccctggggagttcccccagaagcaatatctcctggaaatgtccaaagcagggctcag
atgctactggatcagtaccggaaaaagtcaaaacttttccgcaccaaagttctcctggct
ccgctcggagacgattttcggttcagtgaatacacagagtgggacctgcagtacaggaac
tatgagcagttattcagttacatgaactctcagccccatcttaaagtgaagatccagttt
ggaactttgtcagattatttcgatgcattggagaagtctgtggcagctgagaagaagggt
ggccagtctgtgttccccgccctgagtggagacttcttcacctacgctgaccgagacgac
cattactggagtggctacttcacatccagacctttctacaaacgaatggacaggataatg
gaatctcgtttaaggactgctgaaattctttaccatttggccttgaaacaagctcagaaa
tacaagataaataaatttctttcatcacctcattatacaacactgacagaagccagaagg
aacttgggactgtttcagcatcatgatgccatcacgggaaccgcgaaagactgggtggtc
gtggactatggtaccagactctttcagtcattaaattctctggagaagataatcggagat
tctgcatttcttctcattttaaaggacaaaaagctgtaccagtcagatccttccaaagcc
ttcttagagatggacacgaagcaaagttcacaagattctctgcccaaaaaaaatataata
caactgagtgcacaggagccgaggtacctcgtggtctacaatcccttcgaacaagaacgg
cactcggtggtgtccgtccgtgtgaactcagccacggtgaaagtgctgtctgatctgggg
aaagccgtggaggttcaagtcagcgcagtctggaaggatatgagaacgacttcacaagca
gcctatgaggtcgcttttctagctcatctgccaccgctgggactgaaagtgtacaagatc
ttagaatcccagagttcaagttcacatctggctgattatttcctatataacaatgacggg
caagcagaaagtggaatattccacatgaagaacatggtagattcaggagatgccatcacc
atagagaattccttcctcacacttgggtttgaccgatctgggctgatggagaaagtgaga
aggaaagaagacaataaacagcaggaactgaaggtgcagttcctgtggtacggaaccacc
aacaaaagggacaagagcggtgcctacctcttcctgcctgatgggcagggccagccctat
gtttccctgagaacaccctttgtcagagtgacacgtggaaggatctactcagacgtgacc
tgcttccttgaacacgttactcacaaggtccggctgtaccacatacagggaatagaaggc
cagtccatggaggtttctaatatcgtggacatcaggagtgtgcataaccgtgagattgta
atgagaatttcctccaaaataaacaaccaaaatagatattataccgacctaaatggatat
cagattcaacctagaaggacaatggccaaactgcctcttcaggccaatgtgtacccgatg
agcacaatggcctacatccaggatgctgcacatcggctcacactgctttccgctcagtct
ttaggcgcttccagtatggcctctggtcaaattgaagtcttcatggaccgaagactcatg
caggacgataaccgtggccttgggcaaggtgtacacgataataagattacagccaatttg
tttcgaatcctgctagagaagagaaatggcatgaacatggaagaggacaagaagagccct
gtcagctacccttccctcctcagccatatgacctcggccttcctcaaccatcccttcctc
cccatggtactaagtggccagctcccctcccctgccattgagctgctgagtgaatttcgt
ctgctgcagtcctctctcccttgtgatatccatctggttaatctacggacaatacagtca
aaggtgggcaaaggttactcagatgaggcagccttgatcctccacaggaaggtgtttgat
tgccagttgtccagcagagccatggggctgccctgttccacgactcagggaaagatgtca
attccaaaacttttcaacaactttgctgtggagagtttcatcccttcctcgctgtccttg
atgcactcgcctccggacgcccagaacacgagtgaagtcagcctgagtcccatggagatt
agcacgtcccgaatccgcttgaggtga

DBGET integrated database retrieval system