KEGG   Rattus norvegicus (rat): 25479Help
Entry
25479             CDS       T01003                                 

Gene name
Vps35, Mem3
Definition
(RefSeq) VPS35 retromer complex component
  KO
K18468  vacuolar protein sorting-associated protein 35
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    25479 (Vps35)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    25479 (Vps35)
Membrane trafficking [BR:rno04131]
 Endosome - Lysosome transport
  Rab GTPases and associated proteins
   Retromer subcomplex
    25479 (Vps35)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Vps35 FerA ADIP
Motif
Other DBs
NCBI-GeneID: 25479
NCBI-ProteinID: NP_001099188
RGD: 1589784
Ensembl: ENSRNOG00000017612
UniProt: G3V8A5
Position
19q11
AA seq 796 aa AA seqDB search
MPTTQQSPQDEQEKLLDEAIQAVKVQSFQMKRCLDKNKLMDALKHASNMLGELRTSMLSP
KSYYELYMAISDELHYLEVYLTDEFAKGRKVADLYELVQYAGNIIPRLYLLITVGVVYVK
SFPQSRKDILKDLVEMCRGVQHPLRGLFLRNYLLQCTRNILPDEGEPTDEETTGDISDSM
DFVLLNFAEMNKLWVRMQHQGHSRDREKRERERQELRILVGTNLVRLSQLEGVNVERYKQ
IVLTGILEQVVNCRDALAQEYLMECIIQVFPDEFHLQTLNPFLRACAELHQNVNVKNIII
ALIDRLALFAHREDGPGIPAEIKLFDIFSQQVATVIQSRQDMPSEDVVSLQVSLINLAMK
CYPDRVDYVDKVLETTVEIFNKLNLEHIATSSAVSKELTRLLKIPVDTYNNILTVLKLKH
FHPLFEYFDYESRKSMSCYVLSNVLDYNTEIVSQDQVDSIMNLVSTLIQDQPDQPVEDPD
PEDFADEQSLVGRFIHLLRSEDPDQQYLILNTARKHFGAGGNQRIRFTLPPLVFAAYQLA
FRYKENSQMDDKWEKKCQKIFSFAHQTISALIKAELAELPLRLFLQGALAAGEIGFENHE
TVAYEFMSQAFSLYEDELSDSKAQLAAITLIIGTFERMKCFSEENHEPLRTQCALAASKL
LKKPDQGRAVSTCAHLFWSGRNTDKNGEELHGGKRVMECLKKALKIANQCMDPSLQVQLF
IEILNRYIYFYEKENDAVTIQVLNQLIQKIREDLPNLESSEETEQINKHFHNTLEHLRSR
RESPESEGPIYEGLIL
NT seq 2391 nt NT seq  +upstreamnt  +downstreamnt
atgcctacaacacagcaatcaccccaggatgagcaagaaaaactcttggatgaagccatc
caggctgtgaaagttcaatcattccagatgaaaagatgcctggacaaaaacaagctgatg
gacgctctgaaacatgcctcgaatatgcttggagaactccggacttctatgttatcacca
aagagttactatgaactttatatggctatttctgatgagctgcactacttggaggtctat
ttgactgatgaatttgctaaaggaagaaaggtggcagatctctatgaacttgtacagtat
gctggaaacattattccaaggctttatctcttgatcacagttggagttgtgtatgtcaag
tcatttcctcagtccaggaaagatattctgaaagatttggtagaaatgtgccgtggcgtg
cagcatccactaaggggtttgtttcttcgaaattatcttcttcagtgtactaggaacatt
ttacctgatgaaggagagccaacagatgaagaaacaactggtgatatcagtgattccatg
gattttgtactactcaactttgcagaaatgaataagctctgggtgcggatgcagcatcaa
ggacatagtcgagatagagaaaaaagagaacgagagagacaagaactgagaattttagtg
ggaactaatttggtgcgccttagtcagttggaaggtgtaaatgtggaacgttacaaacag
attgttttaacaggcattttggagcaagttgtgaattgtagagatgctttggctcaagag
tatctcatggagtgcatcattcaggtttttcctgatgaattccatctccagactttgaat
ccttttcttagagcttgtgctgagttacaccaaaatgtaaatgtgaaaaacataatcatt
gctttaattgacagattagctttatttgctcatcgtgaagatggacctggaattccagct
gagattaaactttttgacatattttcacaacaggtggctacagtgatacagtccagacaa
gacatgccatcagaggacgttgtatctttacaagtctctctcattaatcttgctatgaaa
tgttaccctgatcgtgtggactatgttgataaagttctagaaacaacagtggagatattc
aataaacttaaccttgaacatattgctaccagtagtgcagtttcaaaggagcttaccaga
cttttgaagattccagttgatacttacaacaatatcttaacagtcttaaagttaaagcat
ttccacccactttttgagtactttgactacgagtccagaaagagcatgagctgttatgtg
cttagtaatgttctggattataacacagaaatcgtctctcaggaccaggtagattccata
atgaatttggtgtccacgttgattcaggatcagccagaccagcctgtagaagaccctgac
ccagaagactttgctgatgaacagagccttgttggccgatttattcaccttctgcgttct
gaagaccctgatcagcagtatttgattttgaatacagcacgaaaacattttggggctggt
ggaaatcagcggattcgcttcacactgccacctttggtatttgcagcttatcagttggct
tttcggtacaaagagaattctcaaatggatgacaaatgggaaaagaaatgccagaagatt
ttttcatttgcccatcagactatcagtgctttgattaaagccgagctggctgagttacca
ctgagactttttcttcaaggagcattagctgctggggagattggcttcgaaaatcatgaa
acagtagcatatgaatttatgtcccaggcgttttctctatatgaggatgaactcagtgac
tccaaagcacagctggctgctatcactttgatcattggtacttttgagaggatgaaatgc
ttcagtgaagagaatcatgagcccttgagaactcagtgtgcacttgctgcatcaaaactt
ctgaaaaaaccggaccaaggccgagctgtgagcacatgtgcacatctcttttggtctggc
cgaaacacagacaaaaatggggaagagcttcatggaggtaaaagggtcatggagtgccta
aagaaggcactaaaaatagcaaatcagtgcatggacccctctctacaagttcagctcttt
atagagattctgaacaggtacatctatttctatgaaaaagaaaatgatgcggtaacaatt
caggtcttgaaccaacttattcaaaaaattcgagaagatctcccaaaccttgagtccagt
gaagaaacagagcaaattaacaagcattttcacaacacgttggagcacttgcgctcaaga
cgggaatcaccagagtctgaggggccaatctatgaaggtctcatcctttaa

DBGET integrated database retrieval system