KEGG   Rattus norvegicus (rat): 25485Help
Entry
25485             CDS       T01003                                 

Gene name
Myo1d, Myo1c, Myr2, Myr4
Definition
(RefSeq) myosin ID
  KO
K10356  myosin I
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    25485 (Myo1d)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    25485 (Myo1d)
   03036 Chromosome and associated proteins [BR:rno03036]
    25485 (Myo1d)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    25485 (Myo1d)
   04147 Exosome [BR:rno04147]
    25485 (Myo1d)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     25485 (Myo1d)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Phagocytosis
   Others
    25485 (Myo1d)
 Others
  Actin-binding proteins
   Myosins
    25485 (Myo1d)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic Type
  Chromatin remodeling factors
   B-WICH complex
    25485 (Myo1d)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     25485 (Myo1d)
Exosome [BR:rno04147]
 Exosomal proteins
  Proteins found in most exosomes
   25485 (Myo1d)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Myosin_head Myosin_TH1 IQ Sigma54_activat Zeta_toxin AAA_22 AAA_18 AAA_16
Motif
Other DBs
NCBI-GeneID: 25485
NCBI-ProteinID: NP_037115
RGD: 621321
Ensembl: ENSRNOG00000003276
UniProt: Q63357
Position
10q26
AA seq 1006 aa AA seqDB search
MAEQESLEFGKADFVLMDTVSMPEFMANLRLRFEKGRIYTFIGEVVVSVNPYKVLNIYGR
DTIEQYKGRELYERPPHLFAIADAAYKAMKRRSKDTCIMISGESGAGKTEASKYIMQYIA
AITNPSQRAEIERVKNMLLKSNCVLEAFGNAKTNRNDNSSRFGKYMDINFDFKGDPIGGH
INNYLLEKSRVIVQQPGERSFHSFYQLLQGGSEQMLHSLHLQKSLSSYNYIRVGAQLKSS
INDAAEFKVVADAMKVIGFKPEEIQTVYKILAAILHLGNLKFIVDGDTPLIENGKVVSVI
AELLSTKADMVEKALLYRTVATGRDIIDKQHTEQEASYGRDAFAKAIYERLFCWIVTRIN
DIIEVKNYDTTVHGKNTVIGVLDIYGFEIFDNNSFEQFCINYCNEKLQQLFIQLVLKQEQ
EEYQREGIPWKHIDYFNNQIIVDLVEQQHKGIIAILDDACMNVGKVTDGMFLEALNSKLG
KHGHFSSRKTCASDKILEFDRDFRIRHYAGDVVYSVIGFIDKNKDTLFQDFKRLMYNSSN
PVLKNMWPEGKLSITEVTKRPLTAATLFKNSMIALVDNLASKEPYYVRCIKPNDKKSPQI
FDDERCRHQVEYLGLLENVRVRRAGFAFRQTYEKFLHRYKMISEFTWPNHDLPSDKEAVK
KLIERCGFQDDVAYGKTKIFIRTPRTLFTLEELRAQMLVRVVLFLQKVWRGTLARMRYKR
TKAALTIIRYYRRYKVKSYIHEVARRFHGVKNMRDYGKHVKWPTPPKVLRRFEEALQSIF
NRWRASQLIKTIPASDLPQVRAKVAAMEMLKGQRADLGLQRAWEGNYLASKPDTPQTSGT
FVPVANELKRKDKYMNVLFSCHVRKVNRFSKVEDRAIFVTDRHLYKMDPTKQYKVMKTIP
LYNLTGLSVSNGKDQLVVFHTKDNKDLIVCLFSKQPTHESRIGELVGVLVNHFKSEKRHL
QVNVTNPVQCSLHGKKCTVSVETRLNQPQPDFTKNRSGFILSVPGN
NT seq 3021 nt NT seq  +upstreamnt  +downstreamnt
atggcggagcaggagagccttgagtttggcaaggcggacttcgtgctgatggacaccgtc
tccatgcccgagttcatggccaaccttaggctcagatttgagaaaggacgcatctataca
ttcattggcgaggtggtcgtttccgtgaacccatacaaggtgctgaacatctatggaagg
gacacaattgagcagtacaaaggtcgggagctgtacgagagacctcctcatctcttcgct
attgctgacgctgcttacaaggctatgaagaggcgatcaaaagacacctgtattatgata
tcaggggaaagtggagctggtaaaacagaggccagtaagtacatcatgcagtatatcgcc
gccatcaccaaccccagccagagagcagagatagaaagagtgaagaatatgttgctgaag
tcaaactgtgttttggaagcttttggaaatgccaaaaccaatcgcaatgacaattccagc
aggtttgggaaatacatggatatcaactttgacttcaagggagaccccattgggggacat
attaataactacttgctggaaaagtctcgtgtaattgtgcaacagcccggagaacgaagc
ttccattctttctatcagctacttcagggaggttccgagcagatgctgcattctctacat
ctgcagaaatcactctcatcctacaactacatccgtgtgggggcacaactgaagtcttcc
atcaatgatgctgcagagttcaaagttgtagctgatgccatgaaagtaattggattcaaa
cctgaggagattcaaacagtgtataaaattctggctgctattcttcacttgggaaattta
aaatttatagtagatggtgacacgccacttattgagaatggcaaagttgtatctgtcata
gcagaattgctctcaaccaaggcagacatggtggagaaagccctgctttaccggacggtg
gccacaggccgtgacatcattgacaaacagcacacggaacaggaggctagctacggcaga
gacgcctttgccaaggcaatatatgagcgcctcttttgttggattgttactcgcatcaat
gacatcatcgaggtcaagaactacgacaccacagtacatgggaaaaacacagttattggc
gtcttggatatctatggctttgaaatctttgacaacaacagcttcgagcagttctgcatt
aactactgcaatgagaagctgcagcagctgttcattcagctggtgctgaagcaggagcaa
gaggagtaccagcgggaaggaatcccctggaaacacattgattacttcaacaaccagatc
attgtggacctcgtggagcagcagcacaaaggcatcattgcaatcctggatgacgcgtgt
atgaatgttggcaaagtcactgatggaatgttcctcgaggcccttaacagtaaattgggc
aaacatggtcatttttccagccgaaagacctgtgcctcagacaaaatcctggagtttgat
cgggactttcgaatccggcattatgcaggtgatgtcgtgtattctgtcatcggtttcatt
gacaaaaacaaagatactttatttcaagacttcaagcgcctcatgtataacagctcaaat
cctgtgctgaagaacatgtggccggaaggcaaactgagcattacagaggtgaccaagagg
cctctgaccgccgccaccctgtttaagaattccatgattgctttagtagacaaccttgct
tcaaaggagccatactatgtacgttgcatcaaacccaacgacaagaagtccccacagatt
tttgatgatgagcgctgccgccatcaggtagaatacctgggactcctggaaaatgtgaga
gtgcgccgggcagggtttgccttccgccagacctatgagaagtttcttcacagatacaag
atgatctctgagttcacctggcctaaccacgaccttccttcagacaaggaggctgtcaag
aaactcatagagcgatgtggctttcaggatgacgtagcatatgggaagaccaaaattttc
attcgaacaccccgtacgctgttcactttggaagaactccgcgcccagatgctcgtcagg
gttgtcctcttcctacaaaaggtgtggcgtggcaccctggcccgcatgcggtacaagagg
accaaggcagctctgacaataatcaggtactaccggcgctataaagtgaagtcgtacatc
cacgaggtagccaggcgattccacggggtcaagaacatgagagactacgggaagcacgtg
aagtggccaaccccacccaaagtcctgcggcgttttgaggaggccctgcagtcgattttt
aatagatggagagcatcccaactcatcaagaccatacctgcatcagaccttccccaggtc
agggcaaaggttgcagccatggagatgttgaaaggtcaaagggcagaccttgggctccag
agggcctgggaaggcaactatcttgcttcaaagccagatacacctcagacctcgggcact
ttcgtcccagttgctaatgagctgaaacgcaaggacaaatatatgaatgttctcttttcc
tgtcatgtccgaaaggtgaatcgatttagtaaggtagaagaccgagcaatttttgtcact
gaccgtcacctgtataaaatggaccccactaagcagtacaaggtgatgaagaccatccca
ctgtacaatttgactggcctgagtgtgtccaatggaaaggaccagcttgtagtgttccac
acaaaagacaacaaagacctcatcgtctgcctcttcagcaaacagccgacccatgagagc
cggattggagaacttgttggagtcctggtgaatcatttcaagagtgagaagcgccacctt
caagtgaacgtcaccaacccggtgcagtgcagcctgcatgggaagaaatgcaccgtatcc
gtggagacccggcttaaccagccacagcctgacttcaccaagaaccgctccggcttcatc
ctcagtgtgcccgggaattga

DBGET integrated database retrieval system