KEGG   Rattus norvegicus (rat): 25495
Entry
25495             CDS       T01003                                 

Gene name
Nog
Definition
(RefSeq) noggin precursor
  KO
K04658  noggin
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    25495 (Nog)
SSDB
Motif
Pfam: Noggin
Other DBs
NCBI-GeneID: 25495
NCBI-ProteinID: NP_037122
RGD: 3183
Ensembl: ENSRNOG00000023683
UniProt: G3V8X8
Position
10
AA seq 232 aa
MERCPSLGVTLYALVVVLGLRAAPAGGQHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKD
LNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGPAGGAEDLAELDQLLRQRPSGAMPSEI
KGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFS
KRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIISECKCSC
NT seq 699 nt   +upstreamnt  +downstreamnt
atggagcgctgccccagcctgggggtcaccctctacgccctggtggtggtcctggggctg
cgggcagcaccagccggcggccagcactatctacacatccgcccagcacccagcgacaac
ctgcccctggtggacctcatcgaacatccagaccctatctttgaccctaaggagaaggat
ctgaacgagacgctgctgcgctcgctgctcgggggccactacgacccgggttttatggcc
acttcacccccagaggaccgacccggagggggcgggggaccggctggaggtgccgaggac
ctggcggagctggaccagctgctgcggcagcggccgtcgggggccatgccgagcgagatc
aaagggctggagttctccgagggcttggcccaaggcaagaagcagcgcctgagcaagaag
ctgaggaggaagttacagatgtggctgtggtcacagaccttctgcccggtgctgtacgcg
tggaacgacctaggcagccgtttttggccgcgctacgtgaaggtgggcagctgcttcagc
aagcgctcctgctctgtgcctgagggcatggtgtgtaagccatccaagtctgtgcacctc
accgtgctgcggtggcgctgtcagcggcgcgggggtcagcgctgcggctggattcccatc
cagtaccccatcatttccgagtgtaagtgttcctgctag

DBGET integrated database retrieval system