KEGG   Rattus norvegicus (rat): 25504
Entry
25504             CDS       T01003                                 

Gene name
Oxt
Definition
(RefSeq) oxytocin/neurophysin 1 prepropeptide
  KO
K05243  oxytocin-neurophysin 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04024  cAMP signaling pathway
rno04080  Neuroactive ligand-receptor interaction
rno04921  Oxytocin signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    25504 (Oxt)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    25504 (Oxt)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    25504 (Oxt)
SSDB
Motif
Pfam: Hormone_5 Hormone_4
Other DBs
NCBI-GeneID: 25504
NCBI-ProteinID: NP_037128
RGD: 3238
Ensembl: ENSRNOG00000021225
UniProt: P01179
Position
3q36
AA seq 125 aa
MACPSLACCLLGLLALTSACYIQNCPLGGKRAALDLDMRKCLPCGPGGKGRCFGPSICCA
DELGCFVGTAEALRCQEENYLPSPCQSGQKPCGSGGRCATAGICCSPDGCRTDPACDPES
AFSER
NT seq 378 nt   +upstreamnt  +downstreamnt
atggcctgccccagtcttgcttgctgcctgcttggcctactggctctgacctccgcctgc
tacatccagaactgccccctgggcggcaagagggctgcgctagacctggatatgcgcaag
tgtcttccctgcggacccggcggcaaagggcgctgcttcgggccgagcatctgctgcgcg
gacgagctgggctgcttcgtgggcaccgccgaggcgctgcgctgccaggaggagaactac
ctgccctcgccctgccagtctggccagaagccttgcggaagcggaggccgctgcgccacc
gcgggcatctgctgtagcccggatggctgccgcaccgaccccgcctgcgaccctgagtct
gccttctccgagcgctga

DBGET integrated database retrieval system