KEGG   Rattus norvegicus (rat): 25505Help
Entry
25505             CDS       T01003                                 

Gene name
P2rx1, P2XMR
Definition
(RefSeq) purinergic receptor P2X 1
  KO
K05215  P2X purinoceptor 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04020  Calcium signaling pathway
rno04080  Neuroactive ligand-receptor interaction
rno04611  Platelet activation
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    25505 (P2rx1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    25505 (P2rx1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    25505 (P2rx1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    25505 (P2rx1)
Ion channels [BR:rno04040]
 Ligand-gated channels
  ATP-gated cation channel (P2X)
   25505 (P2rx1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: P2X_receptor
Motif
Other DBs
NCBI-GeneID: 25505
NCBI-ProteinID: NP_037129
RGD: 3240
Ensembl: ENSRNOG00000017606
UniProt: P47824
Position
10q24
AA seq 399 aa AA seqDB search
MARRLQDELSAFFFEYDTPRMVLVRNKKVGVIFRLIQLVVLVYVIGWVFVYEKGYQTSSD
LISSVSVKLKGLAVTQLQGLGPQVWDVADYVFPAHGDSSFVVMTNFIVTPQQTQGHCAEN
PEGGICQDDSGCTPGKAERKAQGIRTGNCVPFNGTVKTCEIFGWCPVEVDDKIPSPALLR
EAENFTLFIKNSISFPRFKVNRRNLVEEVNGTYMKKCLYHKIQHPLCPVFNLGYVVRESG
QDFRSLAEKGGVVGITIDWKCDLDWHVRHCKPIYQFHGLYGEKNLSPGFNFRFARHFVQN
GTNRRHLFKVFGIHFDILVDGKAGKFDIIPTMTTIGSGIGIFGVATVLCDLLLLHILPKR
HYYKQKKFKYAEDMGPGEGEHDPVATSSTLGLQENMRTS
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atggctcggcggctgcaagatgagctgtcagccttcttctttgaatatgacactccccgg
atggtgctggtacgaaacaagaaggtgggagtcattttccgtctgatccagttggtggtt
ctggtctacgtcattgggtgggtgtttgtctatgaaaaaggataccagacctcaagtgac
ctcatcagcagtgtgtccgtgaagctcaagggcttggctgtgacccagctccagggcctg
ggaccccaggtctgggacgtggctgactatgtcttcccagcacacggggacagctccttt
gtagttatgaccaacttcatcgtgacccctcagcagactcaaggccattgtgcagagaac
ccagaaggtggcatatgccaggatgacagtggctgcactccaggaaaagcagaaaggaaa
gcccaaggtattcgcacaggcaactgtgtgcccttcaatggcactgtgaagacatgtgag
atctttggttggtgtcctgtagaggtggatgacaagatcccaagccctgctcttcttcgt
gaggctgagaacttcaccctcttcatcaaaaacagcatcagctttccacgcttcaaggtc
aacaggcgcaacctggtagaggaggtgaatggcacctacatgaagaagtgcctctatcac
aagattcaacaccccctgtgcccagtcttcaaccttggctatgtggtgcgagagtcaggc
caggacttccgcagccttgctgagaagggtggggtggttggtatcaccattgactggaag
tgtgatctggactggcacgttcggcactgcaaacccatctaccagttccacggactgtat
ggggagaagaacctgtctccaggcttcaacttcagatttgccaggcatttcgtgcagaat
gggacaaaccgtcgtcacctcttcaaggtgtttgggattcactttgatatccttgtggat
ggcaaggctgggaagtttgacatcatccctactatgactactatcggttctgggattggc
atctttggagtggccacagtgctttgtgatctcttattgctccacatcctgcctaagagg
cactactacaagcagaagaagttcaaatatgccgaggacatggggccgggagagggtgaa
catgaccccgtggccaccagctccactctgggcctgcaggagaacatgaggacctcctga

DBGET integrated database retrieval system