KEGG   Rattus norvegicus (rat): 25512Help
Entry
25512             CDS       T01003                                 

Gene name
Phex, PEX
Definition
(RefSeq) phosphate regulating endopeptidase homolog, X-linked
  KO
K08636  phosphate-regulating neutral endopeptidase [EC:3.4.24.-]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:rno01002]
    25512 (Phex)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.-  
     25512 (Phex)
Peptidases [BR:rno01002]
 Metallo Peptidases
  Family M13: neprilysin family
   25512 (Phex)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M13_N Peptidase_M13
Motif
Other DBs
NCBI-GeneID: 25512
NCBI-ProteinID: NP_037136
RGD: 3323
Ensembl: ENSRNOG00000023440
UniProt: O35812
Position
Xq21
AA seq 749 aa AA seqDB search
MEAEAGSTMETGKGTNRGIRIALALFITGTLVLGTLLFLVSQGLLSFQAKQEYCLKPECI
EAAAAIMSKVNLSVDPCENFFRFACDGWISNNPIPEDMPSYGVYPWLRHNVDLKLKALLE
KSVSRRRDTEAVQKAKILYSSCMNEKAIEKADAKPLLHILRHSPFRWPVLEANIGPEGVW
SERKFSLLQTLATFRGQYSNSVFIRLYVSPDDKASNEHILKLDQATLSLAVREDFLDNTT
EAKSYRDALYKFMVDTAVLLGANSSRAEHDMKSVLRLEIKIAEIMIPHENRTSEAMYNKM
NISELSAMIPQFDWLGYIKKVIDTRLYPHLKDIGPSENVVVRVPQYFKDLFRILGAERKK
TIANYLVWRMVYSRIPNLSRRFQYRWLEFSRVIQGTTTLLPQWDKCVNFIESALPYVVGK
MFVNVHFQEDKKEMMEELIEGVRWAFIDMLEKENEWMDAGTKRKAQEKARAVLAKVGYPE
FIMNDTYVNEDLKAIKFSESDYFGNVLQTRKYLAQSDFFWLKKAVPKTEWFTNPTTVNAF
YSASTNQIRFPAGELQKPFFWGTEYPRSLSYGAIGVIVGHEFTHGFDNNGRKYDKNGNLD
PWWSVDSEEKFKEKTKCMINQYSNYYWKKAGLNVKGKRTLGENIADNGGLREAFRAYRKW
INDRRQGVEEPLLPGITFTNNQLFFLSYAHVRCNSYRPEAAREQVQIGAHSPPQFRVNGA
ISNFEEFQKAFNCPANSTMNRGADSCRLW
NT seq 2250 nt NT seq  +upstreamnt  +downstreamnt
atggaagcagaagcagggagcaccatggagactggaaaggggaccaaccgaggcattcgg
attgcactggccctgttcattactggcaccctggtgctgggcacactgctctttctagtg
agtcaaggtctcctaagtttccaagctaaacaggagtactgcctgaagccagaatgcatt
gaagccgctgctgccatcatgagcaaagtaaatctttctgtggatccttgtgagaatttt
ttccggtttgcttgtgatggctggataagcaataacccaattcctgaagatatgccaagc
tatggggtttatccttggctgagacacaatgttgacctcaagttgaaggcacttctggag
aaatcagtcagtcgaaggcgggacactgaagctgtacagaaagccaaaatcctttattca
tcctgcatgaatgagaaagcgattgaaaaagcagatgccaaaccactgctccacatcttg
aggcattcacctttccgctggcccgtgcttgaagctaatattggtcctgaaggggtttgg
tcagagagaaaattcagtttactgcaaacactggcaacattccgcggtcaatacagcaat
tctgtgttcatccgtttgtacgtgtcccctgacgacaaggcatccaatgagcatatcttg
aagttggaccaagcaacactctccctggctgtgagggaagactttctggataacactacc
gaagccaaatcttatcgtgatgccctttacaaattcatggtggacactgctgtgctttta
ggagctaatagctctcgagctgaacatgacatgaagtcagtgcttagactggaaattaag
atagctgagataatgattccacatgagaaccgaaccagtgaggctatgtataacaaaatg
aacatctcagagctcagtgctatgattccccagtttgactggctgggctatatcaagaag
gtcattgataccagactctacccacacttgaaagacattggcccctcggagaatgtggtg
gtgcgcgtcccacaatactttaaagatttgtttaggatattaggtgctgaaaggaagaaa
accattgccaactatttggtgtggagaatggtttattccagaattccaaacctcagcagg
cgctttcaatatagatggctggaattctcaagggtaatccaggggacaacaactctgctg
cctcagtgggacaaatgtgttaactttatcgaaagtgccctcccttatgttgtggggaaa
atgtttgtgaatgttcacttccaggaagataagaaggaaatgatggaagaattgattgag
ggtgttcgctgggccttcattgacatgctggagaaagaaaatgaatggatggatgcaggg
acaaaaaggaaagctcaagaaaaggcaagagctgttttggcaaaagttggctatccagag
tttataatgaatgatacttatgttaatgaagacctcaaggcaatcaaattttcagaatcg
gactactttggcaacgtactgcaaacccgcaagtatttagcacagtctgatttcttctgg
ctaaaaaaagctgttcccaaaacagagtggtttacaaacccaacaacggtcaatgccttt
tacagtgcatctaccaaccaaatacgatttcctgctggagagctgcagaagcctttcttt
tggggaacagaataccctcgatctctgagttacggtgctataggagtaattgtggggcac
gaatttacacatggatttgataataatggtagaaaatatgataaaaatggaaaccttgat
ccgtggtggtctgtggactctgaagaaaagtttaaggaaaaaacaaaatgcatgattaac
cagtatagcaactattattggaagaaagccggcttaaatgtgaaggggaaaaggaccttg
ggagaaaatattgctgataatggaggtcttcgagaagcttttagggcttacaggaaatgg
ataaatgatagaagacagggagttgaagagcccctcctaccaggcatcacattcaccaac
aatcagctcttcttcctgagttatgctcacgtgaggtgcaattcctacagaccggaagct
gccagagaacaagtccaaattggtgctcacagtcctccacaatttagagtcaatggtgcc
attagcaactttgaagaatttcagaaagcttttaactgtccggcaaattccaccatgaac
agaggtgcagattcctgccgactctggtag

DBGET integrated database retrieval system