KEGG   Rattus norvegicus (rat): 25514Help
Entry
25514             CDS       T01003                                 

Gene name
Lypla1, 25KDL, Pla1a
Definition
(RefSeq) lysophospholipase I
  KO
K06128  lysophospholipase I [EC:3.1.1.5]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00564  Glycerophospholipid metabolism
rno05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    25514 (Lypla1)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    25514 (Lypla1)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     25514 (Lypla1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Abhydrolase_2 Abhydrolase_3 Abhydrolase_1 Hydrolase_4 Abhydrolase_6 Cutinase FSH1 DUF2974 DLH Esterase Palm_thioest Lipase_3
Motif
Other DBs
NCBI-GeneID: 25514
NCBI-ProteinID: NP_037138
RGD: 3025
Ensembl: ENSRNOG00000008320
UniProt: P70470
Position
5q12
AA seq 230 aa AA seqDB search
MCGNNMSAPMPAVVPAARKATAAVIFLHGLGDTGHGWAEAFAGIKSSHIKYICPHAPVMP
VTLNMSMMMPSWFDIIGLSPDSQEDESGIKQAAETVKALIDQEVKNGIPSNRIILGGFSQ
GGALSLYTALTTQQKLAGVTALSCWLPLRASFSQGPINSANRDISVLQCHGDCDPLVPLM
FGSLTVERLKGLVNPANVTFKVYEGMMHSSCQQEMMDVKYFIDKLLPPID
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggcaacaacatgtccgccccgatgcccgccgttgtgcccgccgcccggaaggcc
accgccgcggttattttccttcacggattgggagatactgggcacggatgggcagaagcc
ttcgcaggtatcaaaagttcccacatcaaatacatctgtccacatgcgcctgttatgcca
gtcacactaaacatgagtatgatgatgccttcttggtttgatattattggactttcacca
gattcccaggaggatgaatctggaattaagcaggcggcagaaactgtaaaagccttgata
gatcaagaagtgaagaatggcattccttctaacagaattattttgggaggattttctcag
ggaggcgccttatctttatacactgctctcaccacacagcagaaactggctggtgtcact
gcactcagttgctggcttccacttcgggcttcgttttcacaggggcctatcaatagtgct
aatcgagatatttctgttctccagtgtcatggagactgtgaccctttagttcccctaatg
tttggttctcttactgttgaaagactaaaaggattggtaaatccagccaatgtaaccttc
aaagtctatgaaggcatgatgcacagctcatgtcagcaggaaatgatggatgtcaagtac
ttcattgataagctcctacctccaattgattga

DBGET integrated database retrieval system