KEGG   Rattus norvegicus (rat): 25517Help
Entry
25517             CDS       T01003                                 

Gene name
Pou1f1, GHF1, GHF1A, PIT1Z, Pit1
Definition
(RefSeq) POU class 1 homeobox 1
  KO
K09363  POU domain transcription factor, class 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04935  Growth hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    25517 (Pou1f1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    25517 (Pou1f1)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Helix-turn-helix
   POU domain factors
    25517 (Pou1f1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pou Homeodomain Homeobox_KN Lsr2
Motif
Other DBs
NCBI-GeneID: 25517
NCBI-ProteinID: NP_037140
RGD: 3367
Ensembl: ENSRNOG00000000715
UniProt: Q6P7Q8
Structure
PDB: 

Position
11p12
AA seq 291 aa AA seqDB search
MSCQPFTSADTFIPLNSDASAALPLRMHHNAAEGLPASNHATNVMSTATGLHYSVPSCHY
GNQPSTYGVMAGTLTPCLYKFPDHTLSHGFPPLHQPLLAEDPTASEFKQELRRKSKLVEE
PIDMDSPEIRELEQFANEFKVRRIKLGYTQTNVGEALAAVHGSEFSQTTICRFENLQLSF
KNACKLKAILSKWLEEAEQVGALYNEKVGANERKRKRRTTISIAAKDALERHFGEHSKPS
SQEIMRMAEELNLEKEVVRVWFCNRRQREKRVKTSLNQSLFSISKEHLECR
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgagttgccaacctttcacctcggctgatacctttatacctctgaattctgacgcttct
gctgccctgcctctgagaatgcaccacaatgccgctgagggtctcccagcctccaaccac
gccaccaacgtgatgtccacagcgacaggacttcattattctgtgccttcctgtcattat
ggaaaccagccatccacctacggagtgatggcaggcactttaaccccttgtctttacaag
tttccagaccacaccctgagtcatgggtttcctcccctgcaccaacctctgctggcggag
gacccaacagcctctgaatttaagcaggaactcaggcggaaaagtaaattggtggaagag
ccaatagacatggactccccggaaatccgagaactggagcagtttgccaacgaatttaaa
gtgagaagaattaagttaggatacacccagacaaacgtgggcgaagctctggccgctgtc
cacggctccgaattcagtcaaacaaccatctgccgatttgaaaacttgcagctcagtttc
aaaaatgcttgcaaactgaaagcaattttatccaagtggctggaggaagctgagcaggtc
ggagctttgtacaatgaaaaagtgggagcaaacgaaaggaagaggaaacggaggacaact
atcagtatcgccgctaaggatgctttggagagacactttggagagcacagcaaaccttct
tcgcaggagatcatgcggatggctgaagaattgaatctcgagaaagaagtagtaagagtg
tggttttgcaaccgaaggcagagagaaaaacgggtgaaaacgagtctcaatcaaagtctg
ttctctatttcaaaggagcatcttgagtgcagataa

DBGET integrated database retrieval system