KEGG   Rattus norvegicus (rat): 25520
Entry
25520             CDS       T01003                                 

Gene name
Prkag1, Prkaac, Prkga1
Definition
(RefSeq) protein kinase AMP-activated non-catalytic subunit gamma 1
  KO
K07200  5'-AMP-activated protein kinase, regulatory gamma subunit
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04068  FoxO signaling pathway
rno04152  AMPK signaling pathway
rno04211  Longevity regulating pathway
rno04213  Longevity regulating pathway - multiple species
rno04371  Apelin signaling pathway
rno04530  Tight junction
rno04710  Circadian rhythm
rno04714  Thermogenesis
rno04910  Insulin signaling pathway
rno04920  Adipocytokine signaling pathway
rno04921  Oxytocin signaling pathway
rno04922  Glucagon signaling pathway
rno04931  Insulin resistance
rno04932  Non-alcoholic fatty liver disease
rno05410  Hypertrophic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    25520 (Prkag1)
   04068 FoxO signaling pathway
    25520 (Prkag1)
   04152 AMPK signaling pathway
    25520 (Prkag1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    25520 (Prkag1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    25520 (Prkag1)
   04922 Glucagon signaling pathway
    25520 (Prkag1)
   04920 Adipocytokine signaling pathway
    25520 (Prkag1)
   04921 Oxytocin signaling pathway
    25520 (Prkag1)
  09149 Aging
   04211 Longevity regulating pathway
    25520 (Prkag1)
   04213 Longevity regulating pathway - multiple species
    25520 (Prkag1)
  09159 Environmental adaptation
   04710 Circadian rhythm
    25520 (Prkag1)
   04714 Thermogenesis
    25520 (Prkag1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    25520 (Prkag1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    25520 (Prkag1)
   04931 Insulin resistance
    25520 (Prkag1)
SSDB
Motif
Pfam: CBS Cbl_N3 DUF2497
Other DBs
NCBI-GeneID: 25520
NCBI-ProteinID: NP_037142
RGD: 3388
Ensembl: ENSRNOG00000061499
UniProt: P80385
Structure
PDB: 

Position
7q36
AA seq 330 aa
MESVAAESAPAPENEHSQETPESNSSVYTTFMKSHRCYDLIPTSSKLVVFDTSLQVKKAF
FALVTNGVRAAPLWDSKKQSFVGMLTITDFINILHRYYKSALVQIYELEEHKIETWREVY
LQDSFKPLVCISPNASLFDAVSSLIRNKIHRLPVIDPESGNTLYILTHKRILKFLKLFIT
EFPKPEFMSKSLEELQIGTYANIAMVRTTTPVYVALGIFVQHRVSALPVVDEKGRVVDIY
SKFDVINLAAEKTYNNLDVSVTKALQHRSHYFEGVLKCYLHETLEAIINRLVEAEVHRLV
VVDEHDVVKGIVSLSDILQALVLTGGEKKP
NT seq 993 nt   +upstreamnt  +downstreamnt
atggagtcggttgctgcagagagcgctccagctccggagaatgaacactctcaagagacc
ccggaatcgaacagtagtgtgtacaccaccttcatgaagtctcatcgctgctatgacctg
atccccacaagctccaagctggtggtatttgatacttcgctgcaggtaaagaaagccttc
tttgccctggtgactaacggtgttcgtgctgcccctttgtgggatagtaagaagcagagc
tttgtgggcatgctgaccatcactgacttcatcaatattctgcaccgatactacaagtca
gccctggtgcagatctatgaactggaggagcacaagatagagacttggagagaggtctac
ctgcaagactcctttaagccacttgtctgcatttctccaaatgccagcttgttcgatgct
gtctcttcattaattcgaaataagatccacaggcttccagttattgacccggagtcaggc
aacaccttgtacattcttactcacaagcggatcctcaagttcctcaagttgtttatcact
gagttccccaagccggaattcatgtctaagtctctggaagagctacagattggcacctac
gccaatattgccatggtccgtaccactacacctgtctatgtggctctgggcatctttgta
cagcaccgagtctccgccttgcctgtggtggatgagaaagggcgtgtggtggacatctac
tccaagtttgatgtgattaatttggcagcagaaaagacatacaacaacctagatgtgtct
gtgacaaaagccctacagcaccggtcacactacttcgagggtgttctcaagtgctaccta
catgagactctagaagcaatcatcaatagactggtggaagcagaggttcaccgtctggtg
gtggtggatgaacatgacgtggtcaagggcattgtatcgctgtctgacatcttacaggct
ctggtgctcacaggtggagagaagaagccctga

DBGET integrated database retrieval system