KEGG   Rattus norvegicus (rat): 25520
Entry
25520             CDS       T01003                                 

Gene name
Prkag1
Definition
(RefSeq) 5'-AMP-activated protein kinase subunit gamma-1
  KO
K07200  5'-AMP-activated protein kinase, regulatory gamma subunit
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04068  FoxO signaling pathway
rno04152  AMPK signaling pathway
rno04211  Longevity regulating pathway
rno04213  Longevity regulating pathway - multiple species
rno04371  Apelin signaling pathway
rno04530  Tight junction
rno04710  Circadian rhythm
rno04714  Thermogenesis
rno04910  Insulin signaling pathway
rno04920  Adipocytokine signaling pathway
rno04921  Oxytocin signaling pathway
rno04922  Glucagon signaling pathway
rno04931  Insulin resistance
rno04932  Non-alcoholic fatty liver disease
rno05410  Hypertrophic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    25520 (Prkag1)
   04068 FoxO signaling pathway
    25520 (Prkag1)
   04152 AMPK signaling pathway
    25520 (Prkag1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    25520 (Prkag1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    25520 (Prkag1)
   04922 Glucagon signaling pathway
    25520 (Prkag1)
   04920 Adipocytokine signaling pathway
    25520 (Prkag1)
   04921 Oxytocin signaling pathway
    25520 (Prkag1)
  09149 Aging
   04211 Longevity regulating pathway
    25520 (Prkag1)
   04213 Longevity regulating pathway - multiple species
    25520 (Prkag1)
  09159 Environmental adaptation
   04710 Circadian rhythm
    25520 (Prkag1)
   04714 Thermogenesis
    25520 (Prkag1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    25520 (Prkag1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    25520 (Prkag1)
   04931 Insulin resistance
    25520 (Prkag1)
SSDB
Motif
Pfam: CBS DRTGG Cbl_N3 DUF2497
Other DBs
NCBI-GeneID: 25520
NCBI-ProteinID: NP_037142
RGD: 3388
Ensembl: ENSRNOG00000061499
UniProt: P80385
Structure
PDB: 

Position
7
AA seq 330 aa
MESVAAESAPAPENEHSQETPESNSSVYTTFMKSHRCYDLIPTSSKLVVFDTSLQVKKAF
FALVTNGVRAAPLWDSKKQSFVGMLTITDFINILHRYYKSALVQIYELEEHKIETWREVY
LQDSFKPLVCISPNASLFDAVSSLIRNKIHRLPVIDPESGNTLYILTHKRILKFLKLFIT
EFPKPEFMSKSLEELQIGTYANIAMVRTTTPVYVALGIFVQHRVSALPVVDEKGRVVDIY
SKFDVINLAAEKTYNNLDVSVTKALQHRSHYFEGVLKCYLHETLEAIINRLVEAEVHRLV
VVDEHDVVKGIVSLSDILQALVLTGGEKKP
NT seq 993 nt   +upstreamnt  +downstreamnt
atggagtcggttgctgcagagagcgctccagctccggagaatgaacactctcaagagacc
ccggaatcgaacagtagtgtgtacaccaccttcatgaagtctcatcgctgctatgacctg
atccccacaagctccaagctggtggtatttgatacttcgctgcaggtaaagaaagccttc
tttgccctggtgactaacggtgttcgtgctgcccctttgtgggatagtaagaagcagagc
tttgtgggcatgctgaccatcactgacttcatcaatattctgcaccgatactacaagtca
gccctggtgcagatctatgaactggaggagcacaagatagagacttggagagaggtctac
ctgcaagactcctttaagccacttgtctgcatttctccaaatgccagcttgttcgatgct
gtctcttcattaattcgaaataagatccacaggcttccagttattgacccggagtcaggc
aacaccttgtacattcttactcacaagcggatcctcaagttcctcaagttgtttatcact
gagttccccaagccggaattcatgtctaagtctctggaagagctacagattggcacctac
gccaatattgccatggtccgtaccactacacctgtctatgtggctctgggcatctttgta
cagcaccgagtctccgccttgcctgtggtggatgagaaagggcgtgtggtggacatctac
tccaagtttgatgtgattaatttggcagcagaaaagacatacaacaacctagatgtgtct
gtgacaaaagccctacagcaccggtcacactacttcgagggtgttctcaagtgctaccta
catgagactctagaagcaatcatcaatagactggtggaagcagaggttcaccgtctggtg
gtggtggatgaacatgacgtggtcaagggcattgtatcgctgtctgacatcttacaggct
ctggtgctcacaggtggagagaagaagccctga

KEGG   Rattus norvegicus (rat): 301518
Entry
301518            CDS       T01003                                 

Gene name
Prkag3
Definition
(RefSeq) 5'-AMP-activated protein kinase subunit gamma-3
  KO
K07200  5'-AMP-activated protein kinase, regulatory gamma subunit
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04068  FoxO signaling pathway
rno04152  AMPK signaling pathway
rno04211  Longevity regulating pathway
rno04213  Longevity regulating pathway - multiple species
rno04371  Apelin signaling pathway
rno04530  Tight junction
rno04710  Circadian rhythm
rno04714  Thermogenesis
rno04910  Insulin signaling pathway
rno04920  Adipocytokine signaling pathway
rno04921  Oxytocin signaling pathway
rno04922  Glucagon signaling pathway
rno04931  Insulin resistance
rno04932  Non-alcoholic fatty liver disease
rno05410  Hypertrophic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    301518 (Prkag3)
   04068 FoxO signaling pathway
    301518 (Prkag3)
   04152 AMPK signaling pathway
    301518 (Prkag3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    301518 (Prkag3)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    301518 (Prkag3)
   04922 Glucagon signaling pathway
    301518 (Prkag3)
   04920 Adipocytokine signaling pathway
    301518 (Prkag3)
   04921 Oxytocin signaling pathway
    301518 (Prkag3)
  09149 Aging
   04211 Longevity regulating pathway
    301518 (Prkag3)
   04213 Longevity regulating pathway - multiple species
    301518 (Prkag3)
  09159 Environmental adaptation
   04710 Circadian rhythm
    301518 (Prkag3)
   04714 Thermogenesis
    301518 (Prkag3)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    301518 (Prkag3)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    301518 (Prkag3)
   04931 Insulin resistance
    301518 (Prkag3)
SSDB
Motif
Pfam: CBS
Other DBs
NCBI-GeneID: 301518
NCBI-ProteinID: NP_001100391
RGD: 1308698
Ensembl: ENSRNOG00000017248
UniProt: D4A7E4
Position
9
AA seq 493 aa
MEPELEHTLPGTLTWSHSGGPESQEMDFLEPEENSWPSPTVATSSERTCAIRGVKASRWT
RQEAVEEAEPPGLGEGAQSGPAAESTRQKATFPKATPLAQAVPLADAETSTTGWDLFLPD
CAASAVGSSTGDLELTIEFPGPEVWDCELKGLEQDRPRPCPSPQAPLLSLSWDDELQKPG
AQIYMHFMQEHTCYDAMATSSKLVIFDTTLEIKKAFFAMVANGVRAAPLWDSKKQSFVGM
LTITDFILVLHRYYRSPLVQIYEIEEHKIETWRGFSAEIYLQGCFKPLVSISPNDSLFEA
VYALIKNRIHRLPVLDPVSGTVLYILTHKRLLKFLHIFGALLPRPSFLCRTIQDLGIGTF
RDLAVVLETAPILTALDIFVDRRVSALPVVNESGQVVGLYSRFDVIHLAAQQTYNHLDMS
VGEALRQRTLCLEGVLSCQPHESLGEVIDRIAREQVHRLVLVDETQHLLGVVSLSDILQA
LVLSPAGIDALSA
NT seq 1482 nt   +upstreamnt  +downstreamnt
atggagcccgagctggagcacacactgcctgggaccctgacctggagccacagtgggggt
ccagagagccaagagatggacttcttagaaccagaagaaaactcatggccatcgccaact
gtggccaccagctcagagagaacctgtgctatacggggagtcaaagcttccagatggacg
agacaggaggccgtagaggaagcagagccaccaggtttgggagaaggtgcccagtctgga
ccagctgctgagtccaccaggcagaaggccacattcccaaaggccacacccttggctcaa
gctgttcccttggctgacgcggagacctccaccacagggtgggacctgttcttgcccgac
tgtgcagcctcagcagtgggctccagcacaggtgacctggagctgaccatagagttccca
ggcccagaggtctgggactgtgagctcaaaggcctggagcaggacaggcctcggccttgc
ccctccccgcaggctccacttctcagcctgagttgggacgatgagcttcagaaacctgga
gcccagatctatatgcacttcatgcaagagcacacctgttatgatgccatggccaccagc
tctaaactggtcatctttgacaccacactggagataaagaaagctttctttgccatggtg
gccaacggtgtgagggcagcccctctgtgggacagcaagaagcagagctttgtgggcatg
ctcaccatcacggacttcatcctggtgctgcaccgttactacagatctcccctggtccag
atctatgagattgaagaacacaagattgagacctggaggggtttttctgcagagatctac
ctacaaggttgcttcaagcctctggtctccatctctccaaatgacagtctatttgaagct
gtctatgccctcatcaagaaccgaatccaccgcctgccggtcctggaccctgtctctggc
actgtgctctacatactcacacacaagaggctactcaagttcctgcatatatttggtgcc
ctgttgccccggccctccttcctctgccgcactatccaagacttgggcatcggcacattc
cgagatttagctgtagttctggaaacagctcctatcctgactgcgctggacatctttgtg
gaccgacgagtgtctgcactgcctgtggtcaatgaatctggtcaagtcgtgggcctctac
tcccgctttgatgtcattcacttggctgcacaacaaacttacaaccacctagacatgagt
gtgggagaagctctgaggcagaggacactgtgtctggagggcgttctctcctgccagcct
cacgagagcctaggtgaagtcattgacaggattgcacgggaacaggtgcataggctggtg
ttggtggatgagacccagcatcttctgggtgtggtctccctctctgacatacttcaagcg
ctggtactcagccctgctggcatcgatgccctcagtgcctga

KEGG   Rattus norvegicus (rat): 373545
Entry
373545            CDS       T01003                                 

Gene name
Prkag2
Definition
(RefSeq) 5'-AMP-activated protein kinase subunit gamma-2
  KO
K07200  5'-AMP-activated protein kinase, regulatory gamma subunit
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04068  FoxO signaling pathway
rno04152  AMPK signaling pathway
rno04211  Longevity regulating pathway
rno04213  Longevity regulating pathway - multiple species
rno04371  Apelin signaling pathway
rno04530  Tight junction
rno04710  Circadian rhythm
rno04714  Thermogenesis
rno04910  Insulin signaling pathway
rno04920  Adipocytokine signaling pathway
rno04921  Oxytocin signaling pathway
rno04922  Glucagon signaling pathway
rno04931  Insulin resistance
rno04932  Non-alcoholic fatty liver disease
rno05410  Hypertrophic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    373545 (Prkag2)
   04068 FoxO signaling pathway
    373545 (Prkag2)
   04152 AMPK signaling pathway
    373545 (Prkag2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    373545 (Prkag2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    373545 (Prkag2)
   04922 Glucagon signaling pathway
    373545 (Prkag2)
   04920 Adipocytokine signaling pathway
    373545 (Prkag2)
   04921 Oxytocin signaling pathway
    373545 (Prkag2)
  09149 Aging
   04211 Longevity regulating pathway
    373545 (Prkag2)
   04213 Longevity regulating pathway - multiple species
    373545 (Prkag2)
  09159 Environmental adaptation
   04710 Circadian rhythm
    373545 (Prkag2)
   04714 Thermogenesis
    373545 (Prkag2)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    373545 (Prkag2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    373545 (Prkag2)
   04931 Insulin resistance
    373545 (Prkag2)
SSDB
Motif
Pfam: CBS Cbl_N3
Other DBs
NCBI-GeneID: 373545
NCBI-ProteinID: NP_908940
RGD: 727782
Ensembl: ENSRNOG00000009085
UniProt: Q6V7V4
Position
4
AA seq 326 aa
MLEKLEFQEEEDSESGVYMRFMRSHKCYDIVPTSSKLVVFDTTLQVKKAFFALVANGVRA
APLWESKKQSFVGMLTITDFINILHRYYKSPMVQIYELEEHKIETWRELYLQETFKPLVN
ISPDASLFDAVYSLIKNKIHRLPVIDPISGNALYILTHKRILKFLQLFMSDMPKPAFMKQ
NLDELGIGTYHNIAFIHPNTPIIKALNIFVERRISALPVVDESGKVVDIYSKFDVINLAA
EKTYNNLDITVTQALQHRSQYFEGVVKCSKLETLETIVDRIVRAEVHRLVVVNEADSIVG
IISLSDILQALILTPAGAKQKETETE
NT seq 981 nt   +upstreamnt  +downstreamnt
atgctggagaagctggagttccaggaggaagaagactcagagagtggcgtttatatgcga
ttcatgaggtcacacaagtgttatgacatcgttccaaccagctcaaagcttgttgtcttc
gacactacgttgcaagttaaaaaggccttctttgctttggtagccaacggagtccgtgca
gcgccgctgtgggaaagtaaaaagcagagcttcgtaggaatgctcacaattacagatttc
ataaacatactacacagatactataaatcccccatggtacagatttatgaattggaggaa
cataagattgaaacgtggagggaactgtacttacaagaaaccttcaagcctttggtgaat
atctctccagatgcgagcctcttcgatgctgtatactcgttgatcaaaaataaaatccac
agattgccagttattgaccctatcagtgggaatgcactttatatacttacccacaaaaga
atcctcaagttcctccagctttttatgtctgacatgccaaagcccgccttcatgaagcag
aacctggatgagctcggaataggaacatatcacaatattgccttcattcacccgaatacc
cccatcatcaaagccttgaacatctttgtggagagacggatatctgcgctgcctgtggtg
gatgagtcaggaaaagttgtagatatttactccaagtttgatgtaattaatcttgctgct
gagaaaacgtacaataacctagacatcacggtgacccaggccctgcagcaccgctcacag
tattttgagggtgtggtcaagtgcagtaagctggaaacactggagaccattgtggacaga
atagtgagagccgaggtccatcggttggtggtagtgaatgaagcagatagtattgtgggt
attatctccctgtcagacatcctgcaagccctgatcctcacaccagcaggtgccaaacag
aaggagacagagaccgaatga

KEGG   Rattus norvegicus (rat): 64562
Entry
64562             CDS       T01003                                 

Gene name
Prkab2
Definition
(RefSeq) 5'-AMP-activated protein kinase subunit beta-2
  KO
K07199  5'-AMP-activated protein kinase, regulatory beta subunit
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04068  FoxO signaling pathway
rno04152  AMPK signaling pathway
rno04211  Longevity regulating pathway
rno04213  Longevity regulating pathway - multiple species
rno04371  Apelin signaling pathway
rno04530  Tight junction
rno04710  Circadian rhythm
rno04714  Thermogenesis
rno04910  Insulin signaling pathway
rno04920  Adipocytokine signaling pathway
rno04921  Oxytocin signaling pathway
rno04922  Glucagon signaling pathway
rno04931  Insulin resistance
rno04932  Non-alcoholic fatty liver disease
rno05410  Hypertrophic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    64562 (Prkab2)
   04068 FoxO signaling pathway
    64562 (Prkab2)
   04152 AMPK signaling pathway
    64562 (Prkab2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    64562 (Prkab2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    64562 (Prkab2)
   04922 Glucagon signaling pathway
    64562 (Prkab2)
   04920 Adipocytokine signaling pathway
    64562 (Prkab2)
   04921 Oxytocin signaling pathway
    64562 (Prkab2)
  09149 Aging
   04211 Longevity regulating pathway
    64562 (Prkab2)
   04213 Longevity regulating pathway - multiple species
    64562 (Prkab2)
  09159 Environmental adaptation
   04710 Circadian rhythm
    64562 (Prkab2)
   04714 Thermogenesis
    64562 (Prkab2)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    64562 (Prkab2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    64562 (Prkab2)
   04931 Insulin resistance
    64562 (Prkab2)
SSDB
Motif
Pfam: AMPK1_CBM AMPKBI CBM_48
Other DBs
NCBI-GeneID: 64562
NCBI-ProteinID: NP_072149
RGD: 620905
Ensembl: ENSRNOG00000018166
UniProt: Q9QZH4
Structure
PDB: 
4Y0G 4YEE 2LU3 2LU4

Position
2
AA seq 271 aa
MGNTTSERVSGERHGAKAARAEGGGHGPGKEHKIMVGSTDDPSVFSLPDSKLPGDKEFVP
WQQDLDDSVKPTQQARPTVIRWSEGGKEVFISGSFNNWSTKIPLIKSHNDFVAILDLPEG
EHQYKFFVDGQWVHDPSEPVVTSQLGTINNLIHVKKSDFEVFDALKLDSMESSETSCRDL
SSSPPGPYGQEMYVFRSEERFKSPPILPPHLLQVILNKDTNISCDPALLPEPNHVMLNHL
YALSTKDSVMVLSATHRYKKKYVTTLLYKPI
NT seq 816 nt   +upstreamnt  +downstreamnt
atgggaaacaccaccagtgagcgggtgtccggggagcgccacggtgccaaggctgctcga
gctgagggtggcggccatggccccggcaaggagcacaagatcatggtgggaagcaccgac
gaccccagcgtcttcagcctgccggactccaagctccctggggacaaagagtttgtaccc
tggcagcaggatttggatgattctgtgaagcccacccagcaggcccggcctactgttatc
cgctggtctgaagggggcaaggaggtcttcatctctgggtctttcaacaattggagcacc
aagatccctctgattaagagtcataatgacttcgttgccatcctggatcttcccgaggga
gagcaccagtacaagttctttgtggatggacagtgggttcatgatccatcagagcctgtg
gttaccagtcagcttggcacaattaataatttgatccatgtcaagaaatctgattttgaa
gtatttgatgctttaaagttagattctatggaaagctctgagacatcatgtcgagacctg
tccagctcacccccagggccttatggtcaagaaatgtatgtgtttcgatctgaggagaga
ttcaaatccccacccatcctgccccctcacctcctccaagttattcttaacaaggacact
aatatttcatgtgacccagccttacttcctgagcccaatcatgttatgctgaaccatctc
tatgcgctgtccactaaggacagtgtgatggtccttagcgcaacccatcgctacaagaag
aagtacgtcaccacgctgctgtataagcccatctga

KEGG   Rattus norvegicus (rat): 65248
Entry
65248             CDS       T01003                                 

Gene name
Prkaa1
Definition
(RefSeq) 5'-AMP-activated protein kinase catalytic subunit alpha-1
  KO
K07198  5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04068  FoxO signaling pathway
rno04140  Autophagy - animal
rno04150  mTOR signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04152  AMPK signaling pathway
rno04211  Longevity regulating pathway
rno04213  Longevity regulating pathway - multiple species
rno04371  Apelin signaling pathway
rno04530  Tight junction
rno04710  Circadian rhythm
rno04714  Thermogenesis
rno04910  Insulin signaling pathway
rno04920  Adipocytokine signaling pathway
rno04921  Oxytocin signaling pathway
rno04922  Glucagon signaling pathway
rno04931  Insulin resistance
rno04932  Non-alcoholic fatty liver disease
rno05410  Hypertrophic cardiomyopathy
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    65248 (Prkaa1)
   04068 FoxO signaling pathway
    65248 (Prkaa1)
   04151 PI3K-Akt signaling pathway
    65248 (Prkaa1)
   04152 AMPK signaling pathway
    65248 (Prkaa1)
   04150 mTOR signaling pathway
    65248 (Prkaa1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    65248 (Prkaa1)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    65248 (Prkaa1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    65248 (Prkaa1)
   04922 Glucagon signaling pathway
    65248 (Prkaa1)
   04920 Adipocytokine signaling pathway
    65248 (Prkaa1)
   04921 Oxytocin signaling pathway
    65248 (Prkaa1)
  09149 Aging
   04211 Longevity regulating pathway
    65248 (Prkaa1)
   04213 Longevity regulating pathway - multiple species
    65248 (Prkaa1)
  09159 Environmental adaptation
   04710 Circadian rhythm
    65248 (Prkaa1)
   04714 Thermogenesis
    65248 (Prkaa1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    65248 (Prkaa1)
   05410 Hypertrophic cardiomyopathy
    65248 (Prkaa1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    65248 (Prkaa1)
   04931 Insulin resistance
    65248 (Prkaa1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    65248 (Prkaa1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    65248 (Prkaa1)
   03029 Mitochondrial biogenesis [BR:rno03029]
    65248 (Prkaa1)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     65248 (Prkaa1)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   65248 (Prkaa1)
Membrane trafficking [BR:rno04131]
 Autophagy
  Other autophagy associated proteins
   Others
    65248 (Prkaa1)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    65248 (Prkaa1)
  Mitophagy factors
   Other mitophagy factors
    65248 (Prkaa1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr AdenylateSensor ABC1 Kinase-like RIO1 Kdo APH
Other DBs
NCBI-GeneID: 65248
NCBI-ProteinID: NP_062015
RGD: 3387
Ensembl: ENSRNOG00000012799
UniProt: P54645
Structure
PDB: 

Position
2
AA seq 559 aa
MRRLSSWRKMATAEKQKHDGRVKIGHYILGDTLGVGTFGKVKVGKHELTGHKVAVKILNR
QKIRSLDVVGKIRREIQNLKLFRHPHIIKLYQVISTPSDIFMVMEYVSGGELFDYICKNG
RLDEKESRRLFQQILSGVDYCHRHMVVHRDLKPENVLLDAHMNAKIADFGLSNMMSDGEF
LRTSCGSPNYAAPEVISGRLYAGPEVDIWSSGVILYALLCGTLPFDDDHVPTLFKKICDG
IFYTPQYLNPSVISLLKHMLQVDPMKRATIKDIREHEWFKQDLPKYLFPEDPSYSSTMID
DEALKEVCEKFECSEEEVLSCLYNRNHQDPLAVAYHLIIDNRRIMNEAKDFYLATSPPDS
FLDDHHLTRPHPERVPFLVAETPRARHTLDELNPQKSKHQGVRKAKWHLGIRSQSRPNDI
MAEVCRAIKQLDYEWKVVNPYYLRVRRKNPVTSTFSKMSLQLYQVDSRTYLLDFRSIDDE
ITEAKSGTATPQRSGSISNYRSCQRSDSDAEAQGKPSEVSLTSSVTSLDSSPVDVAPRPG
SHTIEFFEMCANLIKILAQ
NT seq 1680 nt   +upstreamnt  +downstreamnt
atgcgcagactcagttcctggagaaagatggcgacggccgagaagcagaagcacgacggg
cgggtgaagatcggccactacatcctgggggacacgctgggcgtcggcaccttcgggaaa
gtgaaggtgggcaagcacgagttgactggacataaagttgctgtgaagatactcaaccgg
cagaagattcgaagcctggacgtggtcgggaaaatccgcagagagatccagaacctgaag
cttttcaggcaccctcatataatcaaactgtaccaggtcatcagtacaccgtctgatatt
ttcatggtcatggaatatgtctcaggaggagagctatttgattatatctgtaaaaatgga
aggttggacgaaaaggagagtcgacgtctgttccagcagatcctttctggtgtggactat
tgtcacaggcatatggtggtccacagagatttgaaacctgaaaacgtcctgcttgatgca
cacatgaatgcaaagatagccgacttcggtctttcaaacatgatgtcagatggtgaattt
ttaagaacgagctgtggctcgcccaattatgctgcaccagaagtaatttcaggaagattg
tacgcaggccctgaagtagacatctggagcagcggggtcattctctatgctttgctgtgt
ggaactctcccttttgatgatgaccacgtgccaactctttttaagaagatatgtgacggg
atattttatacccctcagtatttgaatccctctgtaataagccttttgaagcatatgctg
caggtagatcctatgaagagggccacaataaaagatatcagggaacatgaatggtttaag
caggaccttccaaaatatctctttcctgaagacccgtcttatagttcaaccatgattgat
gatgaagccttaaaagaagtgtgtgagaagttcgagtgctcagaggaggaggtcctcagc
tgcctgtacaacagaaaccaccaggacccactggcagttgcctaccacctcataatagac
aacaggagaataatgaacgaagccaaagatttctacttggcaacaagcccacccgattct
ttcctcgatgatcaccatttaactcggcctcaccctgagagagtaccattcttggttgcc
gaaacaccaagggcccgacacaccctagatgaattaaacccacagaaatccaaacaccaa
ggcgtacggaaggcaaagtggcatttggggattcgaagtcaaagccgacccaatgacatc
atggcagaagtgtgtagagcaatcaagcagttggactatgaatggaaggttgtaaacccc
tattatttgcgtgtgcgaaggaagaaccctgtgacaagcacattttccaaaatgagtcta
cagctataccaagtggatagtaggacttacttattggatttccgaagtattgatgatgag
attacagaagccaaatcagggactgctactccacagagatcgggatccatcagcaactat
cgatcttgccaaaggagcgactccgacgccgaggctcaaggaaagccctcagaagtctct
cttacctcatccgtgacctccctcgactcctctcctgttgacgtagctccaagaccagga
agtcacacgatagaattttttgaaatgtgtgcaaatctaattaaaattcttgcacagtaa

KEGG   Rattus norvegicus (rat): 78975
Entry
78975             CDS       T01003                                 

Gene name
Prkaa2
Definition
(RefSeq) 5'-AMP-activated protein kinase catalytic subunit alpha-2
  KO
K07198  5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04068  FoxO signaling pathway
rno04140  Autophagy - animal
rno04150  mTOR signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04152  AMPK signaling pathway
rno04211  Longevity regulating pathway
rno04213  Longevity regulating pathway - multiple species
rno04371  Apelin signaling pathway
rno04530  Tight junction
rno04710  Circadian rhythm
rno04714  Thermogenesis
rno04910  Insulin signaling pathway
rno04920  Adipocytokine signaling pathway
rno04921  Oxytocin signaling pathway
rno04922  Glucagon signaling pathway
rno04931  Insulin resistance
rno04932  Non-alcoholic fatty liver disease
rno05410  Hypertrophic cardiomyopathy
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    78975 (Prkaa2)
   04068 FoxO signaling pathway
    78975 (Prkaa2)
   04151 PI3K-Akt signaling pathway
    78975 (Prkaa2)
   04152 AMPK signaling pathway
    78975 (Prkaa2)
   04150 mTOR signaling pathway
    78975 (Prkaa2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    78975 (Prkaa2)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    78975 (Prkaa2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    78975 (Prkaa2)
   04922 Glucagon signaling pathway
    78975 (Prkaa2)
   04920 Adipocytokine signaling pathway
    78975 (Prkaa2)
   04921 Oxytocin signaling pathway
    78975 (Prkaa2)
  09149 Aging
   04211 Longevity regulating pathway
    78975 (Prkaa2)
   04213 Longevity regulating pathway - multiple species
    78975 (Prkaa2)
  09159 Environmental adaptation
   04710 Circadian rhythm
    78975 (Prkaa2)
   04714 Thermogenesis
    78975 (Prkaa2)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    78975 (Prkaa2)
   05410 Hypertrophic cardiomyopathy
    78975 (Prkaa2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    78975 (Prkaa2)
   04931 Insulin resistance
    78975 (Prkaa2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    78975 (Prkaa2)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    78975 (Prkaa2)
   03029 Mitochondrial biogenesis [BR:rno03029]
    78975 (Prkaa2)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     78975 (Prkaa2)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   78975 (Prkaa2)
Membrane trafficking [BR:rno04131]
 Autophagy
  Other autophagy associated proteins
   Others
    78975 (Prkaa2)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    78975 (Prkaa2)
  Mitophagy factors
   Other mitophagy factors
    78975 (Prkaa2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr AdenylateSensor Kinase-like ABC1 RIO1 Kdo APH TCAD9
Other DBs
NCBI-GeneID: 78975
NCBI-ProteinID: NP_076481
RGD: 620893
Ensembl: ENSRNOG00000007706
UniProt: Q09137
Position
5
AA seq 552 aa
MAEKQKHDGRVKIGHYVLGDTLGVGTFGKVKIGEHQLTGHKVAVKILNRQKIRSLDVVGK
IKREIQNLKLFRHPHIIKLYQVISTPTDFFMVMEYVSGGELFDYICKHGRVEEVEARRLF
QQILSAVDYCHRHMVVHRDLKPENVLLDAQMNAKIADFGLSNMMSDGEFLRTSCGSPNYA
APEVISGRLYAGPEVDIWSCGVILYALLCGTLPFDDEHVPTLFKKIRGGVFYIPEYLNRS
IATLLMHMLQVDPLKRATIKDIREHEWFKQDLPSYLFPEDPSYDANVIDDEAVKEVCEKF
ECTESEVMNSLYSGDPQDQLAVAYHLIIDNRRIMNQASEFYLASSPPTGSFMDDMAMHIP
PGLKPHPERMPPLIADSPKARCPLDALNTTKPKSLAVKKAKWHLGIRSQSKPYDIMAEVY
RAMKQLDFEWKVVNAYHLRVRRKNPVTGNYVKMSLQLYLVDNRSYLLDFKSIDDEVVEQR
SGSSTPQRSCSAAGLHRPRSSVDSSTAENHSLSGSLTGSLTGSTLSSASPRLGSHTMDFF
EMCASLITALAR
NT seq 1659 nt   +upstreamnt  +downstreamnt
atggctgagaagcagaagcacgacgggcgtgtgaagatcggacactacgtgctgggggac
accctgggcgtcggcaccttcggcaaagtgaagattggagaacatcaattgacaggccat
aaagtggcagttaagatcttaaatagacagaagattcgcagtttagatgttgttggaaaa
ataaaacgagaaattcaaaatcttaaactctttcgtcatcctcatattatcaaactctac
caagtgatcagcactccaacagacttttttatggtaatggaatatgtgtctggaggtgaa
ttgttcgactacatctgtaaacacgggagggttgaagaggtggaagctcgccggctcttc
cagcagattctgtctgccgtggactactgtcacaggcacatggttgtccacagggacctg
aagccagagaacgtgttgctggacgcccagatgaatgctaagatagctgacttcggactc
tctaatatgatgtcagatggtgaatttctacgaactagctgtggatcgccaaattatgca
gcaccggaggtcatctcaggaaggctgtatgcgggtcctgaggttgatatctggagctgt
ggtgttatcctgtatgcccttctctgtggcaccctcccgttcgacgatgagcacgtgcct
acgctctttaagaagatccgagggggtgtgttctacatcccggagtatctcaaccgttct
attgccactctgctgatgcacatgctgcaggtggaccccttgaagcgagcaactatcaaa
gacatacgagagcatgaatggtttaaacaggatttgcccagttacctctttcctgaagac
ccctcctatgatgctaacgtcattgatgatgaggctgtgaaagaagtatgtgaaaaattt
gagtgtacagaatcagaagtgatgaacagtttatacagtggtgaccctcaagaccagctc
gcagtggcttatcatctcatcattgacaatcggagaataatgaaccaagccagtgagttc
tacctcgcctccagtcctccaacgggttccttcatggacgatatggccatgcacattccc
cccggcctgaaaccacatcctgaaaggatgccacctctcatagcagacagccccaaagca
cgctgtccactggatgcactcaacacaactaagcccaaatctttagctgtgaaaaaagcc
aagtggcaccttgggatccgaagccagagcaaaccatacgacattatggcggaggtgtac
cgagctatgaagcagctggactttgaatggaaggtagtgaatgcataccatcttcgagta
agaagaaaaaacccagtgactggcaattacgtgaaaatgagcttacagctttacctggtt
gacaatcggagctatcttctagactttaaaagcatcgatgatgaggtggtggagcagagg
tctggttcttcaacacctcagcgctcctgttctgctgccggcctccacagacctcggtca
agtgtcgattccagcacagccgagaaccattcactgtctggctctctcactggttctttg
actggcagcactttgtcctccgcttccccgcgcctgggcagtcataccatggattttttt
gaaatgtgcgccagtcttatcactgctttagcccgttga

KEGG   Rattus norvegicus (rat): 83803
Entry
83803             CDS       T01003                                 

Gene name
Prkab1
Definition
(RefSeq) 5'-AMP-activated protein kinase subunit beta-1
  KO
K07199  5'-AMP-activated protein kinase, regulatory beta subunit
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04068  FoxO signaling pathway
rno04152  AMPK signaling pathway
rno04211  Longevity regulating pathway
rno04213  Longevity regulating pathway - multiple species
rno04371  Apelin signaling pathway
rno04530  Tight junction
rno04710  Circadian rhythm
rno04714  Thermogenesis
rno04910  Insulin signaling pathway
rno04920  Adipocytokine signaling pathway
rno04921  Oxytocin signaling pathway
rno04922  Glucagon signaling pathway
rno04931  Insulin resistance
rno04932  Non-alcoholic fatty liver disease
rno05410  Hypertrophic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    83803 (Prkab1)
   04068 FoxO signaling pathway
    83803 (Prkab1)
   04152 AMPK signaling pathway
    83803 (Prkab1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    83803 (Prkab1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    83803 (Prkab1)
   04922 Glucagon signaling pathway
    83803 (Prkab1)
   04920 Adipocytokine signaling pathway
    83803 (Prkab1)
   04921 Oxytocin signaling pathway
    83803 (Prkab1)
  09149 Aging
   04211 Longevity regulating pathway
    83803 (Prkab1)
   04213 Longevity regulating pathway - multiple species
    83803 (Prkab1)
  09159 Environmental adaptation
   04710 Circadian rhythm
    83803 (Prkab1)
   04714 Thermogenesis
    83803 (Prkab1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    83803 (Prkab1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    83803 (Prkab1)
   04931 Insulin resistance
    83803 (Prkab1)
SSDB
Motif
Pfam: AMPK1_CBM AMPKBI CBM_48 DUF4758
Other DBs
NCBI-GeneID: 83803
NCBI-ProteinID: NP_114182
RGD: 71057
Ensembl: ENSRNOG00000001142
UniProt: P80386
Structure
PDB: 

Position
12
AA seq 270 aa
MGNTSSERAALERQAGHKTPRRDSSGGTKDGDRPKILMDSPEDADIFHTEEMKAPEKEEF
LAWQHDLEVNEKAPAQARPTVFRWTGGGKEVYLSGSFNNWSKLPLTRSQNNFVAILDLPE
GEHQYKFFVDGQWTHDPSEPIVTSQLGTVNNIIQVKKTDFEVFDALMVDSQKCSDVSELS
SSPPGPYHQEPYISKPEERFKAPPILPPHLLQVILNKDTGISCDPALLPEPNHVMLNHLY
ALSIKDGVMVLSATHRYKKKYVTTLLYKPI
NT seq 813 nt   +upstreamnt  +downstreamnt
atgggcaatacgagcagcgagcgcgccgcgctggagcggcaggctggccataagacgccg
cggagggacagctcggggggcaccaaggatggggacaggcccaagatcctgatggacagc
cccgaagacgccgacatcttccacaccgaggaaatgaaggctccagagaaggaggagttc
ctggcgtggcagcacgacctcgaggtgaatgagaaagcccccgcccaggctcggcccacc
gtatttcgatggacagggggtggaaaggaggtctacttgtctggatccttcaacaactgg
agcaaattgcccctcactagaagccaaaacaacttcgtagccatcctggacctgccggaa
ggagagcatcagtacaagttctttgtggatggccagtggacccacgatccttccgagcca
atagtaaccagccagcttggcacagttaacaacatcattcaagtgaagaaaactgacttt
gaagtatttgatgctttaatggtggattcccaaaagtgctccgatgtatctgagctgtcc
agttcccccccaggaccctaccaccaggagccttacatctctaaaccagaggagcggttc
aaggccccgcccatcctcccgcctcacctgctgcaggtcatcttgaacaaggacacgggc
atctcttgtgatccagcgctgcttccggagcccaaccacgtcatgctgaaccacctctat
gcactctctatcaaggatggagtgatggtgctcagtgcgacccatcggtacaagaaaaag
tacgtcaccaccctcctctacaagcccatatga

DBGET integrated database retrieval system