KEGG   Rattus norvegicus (rat): 25521
Entry
25521             CDS       T01003                                 

Gene name
Prkar1b, RGD1563094, RIbeta
Definition
(RefSeq) protein kinase cAMP-dependent type 1 regulatory subunit beta
  KO
K04739  cAMP-dependent protein kinase regulator
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    25521 (Prkar1b)
SSDB
Motif
Pfam: cNMP_binding
Other DBs
NCBI-GeneID: 25521
NCBI-ProteinID: NP_001028851
RGD: 3392
Ensembl: ENSRNOG00000028733
UniProt: Q3SWU5
Position
12q11
AA seq 359 aa
MMSPQIMCVSVCGEGMGWDPVEISQSHAEGCAQTTGLEENRQILARQKSNSQCDSHDEEI
SPTPPNPVVKARRRRGGVSAEVYTEEDAVSYVRKVIPKDYKTMTALAKAISKNVLFSHLD
DNERSDIFDAMFPVTHIDGETVIQQGNEGDNFYVIDQGEVDVYVNGEWVTNISEGGSFGE
LALIYGTPRAATVKAKTDLKLWGIDRDSYRRILMGSTLRKRKMYEEFLSKVSILESLEKW
ERLTVADALEPVQFEDGEKIVVQGEPGDDFYIITEGTASVLQRRSPNEEYVEVGRLGPSD
YFGEIALLLNRPRAATVVARGPLKCVKLDRPRFERVLGPCSEILKRNIQRYNSFISLTV
NT seq 1080 nt   +upstreamnt  +downstreamnt
atgatgagtccacagatcatgtgtgtctcagtgtgtggggaaggcatgggatgggaccct
gtggaaataagtcagtcacatgctgaaggctgtgctcagactacagggctggaggaaaac
aggcagatcctggctcggcagaagtcaaactcacagtgtgattcccacgatgaggagatc
tccccaacacctccaaatcctgtggtaaaggcacgtcgtcgacggggtggcgtgagtgct
gaagtctacactgaggaagatgccgtctcctacgtgaggaaggtcattcccaaggactat
aagaccatgactgcgctggccaaggccatttctaagaacgtgctcttttctcacctggat
gacaacgagagaagtgacatattcgatgccatgtttcctgtcacccacatcgatggggaa
acagtcatacagcaagggaacgaaggggataatttctacgtgattgaccaaggagaagta
gacgtatatgtgaacggggagtgggtgaccaacatcagtgaggggggaagcttcggggag
ctggccctcatctacggcacccctagagcggctactgtgaaggccaaaacggacctcaag
ctctggggcatcgaccgtgacagctacaggcgcatcctcatgggaagcacactgaggaaa
cgcaagatgtatgaggaattcctcagcaaagtctccatcttagagtctctggagaagtgg
gaacgcctcactgtagctgatgccctggagcctgtgcagtttgaagatggagagaaaatc
gttgtgcagggggagcctggggatgatttctacatcatcacagagggtactgcttcagtc
ctccagcgacgatcccccaacgaggagtatgtggaggtggggcgccttggaccctctgac
tactttggagagattgccctgctgctgaaccggccccgtgcagccactgtggtggcacgg
ggtcccctcaagtgtgtgaagttggaccggcctcgttttgagcgtgtcctgggcccctgc
tctgagatcctgaagagaaacatccagcgttacaacagcttcatctccctaactgtctga

DBGET integrated database retrieval system