KEGG   Rattus norvegicus (rat): 25522
Entry
25522             CDS       T01003                                 

Gene name
Prkcz, 14-3-3-zetaisoform, Pkcz, r14-3-3
Definition
(RefSeq) protein kinase C, zeta
  KO
K18952  atypical protein kinase C zeta type [EC:2.7.11.13]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04015  Rap1 signaling pathway
rno04062  Chemokine signaling pathway
rno04071  Sphingolipid signaling pathway
rno04144  Endocytosis
rno04360  Axon guidance
rno04390  Hippo signaling pathway
rno04530  Tight junction
rno04611  Platelet activation
rno04910  Insulin signaling pathway
rno04926  Relaxin signaling pathway
rno04930  Type II diabetes mellitus
rno04931  Insulin resistance
rno04933  AGE-RAGE signaling pathway in diabetic complications
rno05165  Human papillomavirus infection
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    25522 (Prkcz)
   04390 Hippo signaling pathway
    25522 (Prkcz)
   04071 Sphingolipid signaling pathway
    25522 (Prkcz)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    25522 (Prkcz)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    25522 (Prkcz)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    25522 (Prkcz)
   04062 Chemokine signaling pathway
    25522 (Prkcz)
  09152 Endocrine system
   04910 Insulin signaling pathway
    25522 (Prkcz)
   04926 Relaxin signaling pathway
    25522 (Prkcz)
  09158 Development and regeneration
   04360 Axon guidance
    25522 (Prkcz)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    25522 (Prkcz)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    25522 (Prkcz)
   04931 Insulin resistance
    25522 (Prkcz)
   04933 AGE-RAGE signaling pathway in diabetic complications
    25522 (Prkcz)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    25522 (Prkcz)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    25522 (Prkcz)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     25522 (Prkcz)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   25522 (Prkcz)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PB1 C1_1 Pkinase_C Kinase-like C1_2 APH Kdo
Other DBs
NCBI-GeneID: 25522
NCBI-ProteinID: NP_071952
RGD: 3399
Ensembl: ENSRNOG00000015480
UniProt: P09217
Structure
PDB: 
4MJS

Position
5q36
AA seq 592 aa
MPSRTDPKMDRSGGRVRLKAHYGGDILITSVDPTTTFQDLCEEVRDMCGLHQQHPLTLKW
VDSEGDPCTVSSQMELEEAFRLACQGRDEVLIIHVFPSIPEQPGMPCPGEDKSIYRRGAR
RWRKLYRANGHLFQAKRFNRRAYCGQCSERIWGLARQGYRCINCKLLVHKRCHVLVPLTC
RRHMDSVMPSQEPPVDDKNDGVDLPSEETDGIAYISSSRKHDNIKDDSEDLKPVIDGVDG
IKISQGLGLQDFDLIRVIGRGSYAKVLLVRLKKNDQIYAMKVVKKELVHDDEDIDWVQTE
KHVFEQASSNPFLVGLHSCFQTTSRLFLVIEYVNGGDLMFHMQRQRKLPEEHARFYAAEI
CIALNFLHERGIIYRDLKLDNVLLDADGHIKLTDYGMCKEGLGPGDTTSTFCGTPNYIAP
EILRGEEYGFSVDWWALGVLMFEMMAGRSPFDIITDNPDMNTEDYLFQVILEKPIRIPRF
LSVKASHVLKGFLNKDPKERLGCRPQTGFSDIKSHAFFRSIDWDLLEKKQTLPPFQPQIT
DDYGLDNFDTQFTSEPVQLTPDDEDVIKRIDQSEFEGFEYINPLLLSAEESV
NT seq 1779 nt   +upstreamnt  +downstreamnt
atgcccagcaggaccgaccccaagatggaccggagcggcggccgcgtccgtctgaaggcg
cactacggcggggacatcctgattaccagcgtggaccccacgacaactttccaggacctc
tgtgaggaagtgcgagacatgtgtggcctgcaccagcagcacccactcaccctcaagtgg
gtggacagtgaaggtgacccttgtactgtgtcctcacagatggagctggaggaggccttc
cgcctggcctgtcagggcagggacgaagtgctcatcatccacgttttcccaagcatccca
gaacaaccgggcatgccttgtcctggagaagacaagtccatctaccgccgtggagccaga
agatggaggaagctataccgagccaacggccacctcttccaagccaagcgctttaacagg
agagcgtactgtggccagtgcagcgaaaggatatggggcctcgcgaggcaggggtacagg
tgcatcaactgcaagctgcttgtccataaacgctgccacgtcctcgtcccgctgacctgc
aggaggcatatggattctgtcatgccttcccaagagcctccagtagatgacaagaacgat
ggtgtagaccttccttcagaagaaactgatggaattgcttatatttcttcatctcggaaa
catgacaatatcaaagatgattctgaggaccttaagcctgtcatcgatggggtggatggg
atcaaaatctctcaggggctggggctgcaagactttgacctcatcagagtcatcgggcgt
ggaagctatgccaaggtcctcctggtgcggttgaagaaaaacgaccagatttacgccatg
aaggtggtgaagaaggagctcgtccacgacgatgaggatatcgactgggtgcagacagag
aagcacgtgttcgagcaggcatccagcaaccccttcctggttggcttacactcctgcttc
cagacaacgagccggttgttcctggtcatcgagtatgtcaacgggggggacctcatgttc
cacatgcagaggcagaggaagcttccagaggaacacgccaggttctatgctgctgagatc
tgtatcgctctcaacttcctacatgagagagggatcatctaccgggacctaaaactggac
aacgtcctcctcgatgccgatggacacattaagctgacggactacggcatgtgcaaggaa
ggcctaggccccggcgacacaacaagcactttttgtggaaccccgaactatatcgccccc
gaaatcctgcgaggagaagagtacgggttcagcgtggactggtgggcgctgggtgtcctt
atgtttgagatgatggctgggcgctccccctttgacatcatcacagacaaccctgacatg
aatactgaagactaccttttccaagttatcctggaaaagccaattcggattccccgtttc
ctgtctgtcaaggcctcacacgtcttgaaaggatttttaaataaggatcccaaagagagg
cttggctgccggccgcagactgggttttccgacatcaagtcccatgccttcttccgaagc
atagactgggacctgcttgaaaagaagcagaccctgcctcccttccagccccagatcaca
gatgactatggcctggacaacttcgacacgcagttcaccagcgagcccgtacagctgacc
ccagatgatgaggacgtcataaagaggatcgaccagtccgagttcgaaggcttcgagtac
atcaacccgcttctgctgtctgctgaggagtccgtgtga

DBGET integrated database retrieval system