KEGG   Rattus norvegicus (rat): 25523
Entry
25523             CDS       T01003                                 

Gene name
Prkg2
Definition
(RefSeq) cGMP-dependent protein kinase 2
  KO
K19477  cGMP-dependent protein kinase 2 [EC:2.7.11.12]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04022  cGMP-PKG signaling pathway
rno04540  Gap junction
rno04611  Platelet activation
rno04713  Circadian entrainment
rno04714  Thermogenesis
rno04730  Long-term depression
rno04740  Olfactory transduction
rno04923  Regulation of lipolysis in adipocytes
rno04924  Renin secretion
rno04970  Salivary secretion
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    25523 (Prkg2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    25523 (Prkg2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    25523 (Prkg2)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    25523 (Prkg2)
   04924 Renin secretion
    25523 (Prkg2)
  09154 Digestive system
   04970 Salivary secretion
    25523 (Prkg2)
  09156 Nervous system
   04730 Long-term depression
    25523 (Prkg2)
  09157 Sensory system
   04740 Olfactory transduction
    25523 (Prkg2)
  09159 Environmental adaptation
   04713 Circadian entrainment
    25523 (Prkg2)
   04714 Thermogenesis
    25523 (Prkg2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    25523 (Prkg2)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.12  cGMP-dependent protein kinase
     25523 (Prkg2)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: AGC group
  PKG family
   25523 (Prkg2)
SSDB
Motif
Pfam: Pkinase cNMP_binding PK_Tyr_Ser-Thr Kinase-like RNase_Y_N APH ATG16 MapZ_EC1 DUF5927 FeoB_N ABC1 PspA_IM30 FAM76 UPF0242
Other DBs
NCBI-GeneID: 25523
NCBI-ProteinID: NP_037144
RGD: 3401
Ensembl: ENSRNOG00000002361
UniProt: Q64595
Structure
PDB: 
4OJK

Position
14
AA seq 762 aa
MGNGSVKPKHSKHPDGQSGNLSNEALRSKVAELEREVKRKDAELQEREYHLKELREQLAK
QTVAIAELTEELQSKCIQLNKLQDVIHVQGGSPLQASPDKVPLDVHRKTSGLVSLHSRRG
AKAGVSAEPTSRTYDLNKPPEFSFEKARVRKDSSEKKLITDALNKNQFLKRLDPQQIKDM
VECMYGRNYQQGSYIVKQGEPGNHIFVLAEGRLEVFQGEKLLSSIPMWTTFGELAILYNC
TRTASVKAITNVKTWALDREVFQNIMRRTAQARDEEYRNFLRSVSLLKNLPEDKLTKIID
CLEVEYYDKGDYIIREGEEGSTFFILAKGKVKVTQSTEGHDQPQLIKTLQKGEYFGEKAL
ISDDVRSANIIAEENDVACLVIDRETFNQTVGTFDELQKYLEGYVATLNRDDEKRHAKRS
MSSWKLSKALSLEMIQLKEKVARFSSTSPFQNLEIIATLGVGGFGRVELVKVKNENIAFA
MKCIRKKHIVDTKQQEHVYSEKRILEELCSPFIVKLYRTFKDNKYVYMLLEACLGGELWS
ILRDRGSFDEPTSKFCVACVTEAFDYLHRLGIIYRDLKPENLILDADGYLKLVDFGFAKK
IGSGQKTWTFCGTPEYVAPEVILNKGHDFSVDFWSLGILVYELLTGNPPFSGIDQMMTYN
LILKGIEKMDFPRKITRRPEDLIRRLCRQNPTERLGNLKNGINDIKKHRWLNGFNWEGLK
ARSLPSPLRRELSGPIDHSYFDKYPPEKGVPPDEMSGWDKDF
NT seq 2289 nt   +upstreamnt  +downstreamnt
atgggaaatggttcagtgaaacccaagcattcgaagcacccagacggccagtcagggaac
ctcagcaatgaagccctgcggagcaaagtggcagagctggagcgcgaggtgaagaggaag
gatgcagaacttcaggagcgcgagtaccacctgaaggagcttcgggagcagctggctaag
cagaccgtggccattgcggagctcaccgaggagctgcagagcaagtgcatccagctgaac
aagctgcaggatgttatccacgtgcagggaggaagcccactgcaggcctctcccgacaaa
gtgcctctggatgttcaccgcaagacctcaggcttggtctccctccacagcaggaggggg
gcgaaggctggagtgtctgcagagcccacaagccggacctatgacctcaacaagccccct
gagttctcctttgagaaagcgagggtcaggaaggattccagtgagaaaaaacttatcaca
gacgccctgaataagaaccagtttctgaagagactggatccgcagcagatcaaagacatg
gtggaatgcatgtacgggagaaactatcaacagggcagttacatcgttaagcaaggggaa
cctggaaaccacatctttgtgctggccgagggtagactggaggtgttccaaggagagaaa
ttgctgtcgtccatcccaatgtggaccacgtttggggagctggctattttgtataattgt
acgcggactgcctctgtgaaagctattaccaatgttaaaacttgggctctcgatagagag
gttttccagaacattatgaggagaacggcgcaagccagggatgaggaatacagaaacttc
ctcagaagtgtctccttgttgaagaatttacctgaagacaaactaaccaagattattgac
tgcttggaagtggaatactatgacaaaggagattatatcatcagagaaggagaggaaggg
agcacctttttcatcttggcaaaaggaaaggtgaaagtcacacagagcacagagggccat
gatcagccacagttgatcaaaacactgcagaaaggagagtactttggagaaaaggctctg
atcagtgatgatgtcagatcggccaatataatcgcggaagaaaatgatgtcgcatgcctc
gtgatcgaccgagaaacattcaaccaaactgtcgggacatttgatgaactccaaaaatac
cttgaggggtatgtggccaccctgaaccgtgacgatgaaaagagacacgcaaagcgctcc
atgtctagctggaagttgtccaaagccctttctctggagatgattcagctgaaagagaag
gtggccagattctcctcaacctccccattccagaaccttgagattatcgcaacactgggc
gttggtgggttcggaagagtggagcttgttaaagttaaaaatgagaacatcgcttttgcc
atgaagtgtataaggaagaagcacattgttgacactaaacagcaggaacatgtctactcc
gagaagaggatcctggaggagctgtgttctcccttcatcgtgaaattgtatcgtactttc
aaggacaataaatacgtatacatgcttctggaggcctgcttaggtggggagctctggagt
atattaagggacagaggcagcttcgatgaacccacctccaaattctgtgtggcctgcgtg
acagaagcattcgattatctacaccgactaggcattatctacagagacctgaagccagag
aacttaattctggatgccgatggctaccttaagttggttgactttggattcgctaagaag
attggctctgggcagaaaacgtggacattctgtgggactccagagtatgtggcccccgag
gtcattcttaacaaaggacatgacttcagtgtggatttctggtccctggggattctggtc
tatgagcttctaacgggcaaccctcccttttctgggatagaccaaatgatgacctacaat
ttgattctcaaagggatcgagaaaatggattttcctagaaagataacaaggcgacccgag
gatttgatccggaggctttgcaggcaaaacccaacagaaaggctggggaacctgaagaat
gggatcaacgacattaagaaacacaggtggttaaacggtttcaattgggaggggttgaaa
gcacggagccttccctcacctttacgaagagagctcagtggccccatagatcacagctac
tttgacaagtatcctcctgaaaagggggttcctccggatgaaatgtcaggctgggataag
gacttctga

KEGG   Rattus norvegicus (rat): 54286
Entry
54286             CDS       T01003                                 

Gene name
Prkg1
Definition
(RefSeq) cGMP-dependent protein kinase 1
  KO
K07376  cGMP-dependent protein kinase 1 [EC:2.7.11.12]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04022  cGMP-PKG signaling pathway
rno04270  Vascular smooth muscle contraction
rno04540  Gap junction
rno04611  Platelet activation
rno04713  Circadian entrainment
rno04714  Thermogenesis
rno04730  Long-term depression
rno04740  Olfactory transduction
rno04923  Regulation of lipolysis in adipocytes
rno04970  Salivary secretion
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    54286 (Prkg1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    54286 (Prkg1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    54286 (Prkg1)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    54286 (Prkg1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    54286 (Prkg1)
  09154 Digestive system
   04970 Salivary secretion
    54286 (Prkg1)
  09156 Nervous system
   04730 Long-term depression
    54286 (Prkg1)
  09157 Sensory system
   04740 Olfactory transduction
    54286 (Prkg1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    54286 (Prkg1)
   04714 Thermogenesis
    54286 (Prkg1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    54286 (Prkg1)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.12  cGMP-dependent protein kinase
     54286 (Prkg1)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: AGC group
  PKG family
   54286 (Prkg1)
SSDB
Motif
Pfam: Pkinase cNMP_binding PK_Tyr_Ser-Thr PKcGMP_CC Kinase-like Wtap APH Pkinase_C Med28 Med4 OmpH
Other DBs
NCBI-GeneID: 54286
NCBI-ProteinID: NP_001099201
RGD: 1587390
Position
1
AA seq 671 aa
MSELEEDFAKILMLKEERIKELEKRLSEKEEEIQELKRKLHKCQSVLPVPSTHIGPRTTR
AQGISAEPQTYRSFHDLRQAFRKFTKSERSKDLIKEAILDNDFMKNLELSQIQEIVDCMY
PVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKEGVKLCTMGPGKVFGELAILYNCTRTAT
VKTLVNVKLWAIDRQCFQTIMMRTGLIKHTEYMEFLKSVPTFQSLPDEILSKLADVLEET
HYENGEYIIRQGARGDTFFIISKGKVNVTREDSPSEDPVFLRTLGKGDWFGEKALQGEDV
RTANVIAAEAVTCLVIDRDSFKHLIGGLDDVSNKAYEDAEAKAKYEAEAAFFANLKLSDF
NIIDTLGVGGFGRVELVQLKSEESKTFAMKILKKRHIVDTRQQEHIRSEKQIMQGAHSDF
IVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGSFEDSTTRFYTACVVEAFAYLHSKGI
IYRDLKPENLILDHRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISAD
YWSLGILMYELLTGSPPFSGPDPMKTYNIILRGIDMIEFPKKIAKNAANLIKKLCRDNPS
ERLGNLKNGVKDIQKHKWFEGFNWEGLRKGTLTPPIIPSVASPTDTSNFDSFPEDSDEPP
PDDNSGWDIDF
NT seq 2016 nt   +upstreamnt  +downstreamnt
atgagcgaactggaggaagactttgcgaagattctcatgctcaaggaggagaggatcaaa
gagctggagaagcggctgtcagagaaagaggaagaaatccaggagctgaagaggaaactc
cacaaatgccagtcggtgctgcccgtgccctccacccacattggcccgcggaccacccgg
gcgcagggcatctccgcggagccgcagacctacaggtccttccacgacctgcgccaggcg
ttccggaagttcactaaatccgagaggtcgaaggatctcataaaggaggctatccttgac
aatgacttcatgaagaacttggagctgtcacagatccaggagattgtggattgtatgtac
cccgtggaatatgggaaggacagctgcatcatcaaggaaggcgatgtggggtcactggtg
tatgtcatggaagatgggaaggtcgaagtcacaaaagaaggtgtgaagttgtgcaccatg
ggtcccgggaaagtgttcggggagctggctattctttacaactgtacccggacagcgacc
gtcaagactcttgtaaatgtgaaactctgggccattgatcgacaatgttttcaaacaata
atgatgagaacaggactcatcaagcacaccgagtacatggagtttttaaaaagtgttcca
acattccagagccttcctgatgaaatcctcagcaagctggctgatgtcctcgaagagact
cactatgaaaatggagaatatatcataaggcagggtgcaagaggagacaccttcttcatc
atcagcaaagggaaggtaaacgttacccgagaagactcaccaagtgaagacccagtcttt
cttagaactttagggaagggagattggtttggagagaaagccttgcagggggaggatgta
agaacagcgaacgtcattgctgcagaggctgtcacctgcctcgtgattgacagagactct
ttcaagcatttaattggaggactggatgatgtctctaacaaagcatatgaggatgcagaa
gcgaaagcaaaatatgaagccgaagctgccttcttcgccaacctgaagctgtctgacttc
aacatcattgacacccttggagtgggaggtttcggacgagtggagctggtccagttgaag
agtgaagaatctaaaacatttgcgatgaagatcctcaagaaacgacacattgtggacacg
agacagcaggagcacatccgctcagagaagcagatcatgcagggggctcattccgatttc
atcgtgaggctataccggacatttaaagacagcaaatacttgtatatgttgatggaagct
tgcctaggtggagaactctggactattctcagggataggggttcatttgaagactcgaca
accagattttacacagcatgtgtggtagaagcgtttgcctatctgcattccaaaggaatc
atttacagggacctcaagccagaaaatctcatcctagatcaccgaggttatgccaaactg
gttgactttggctttgcaaagaaaataggatttggaaagaaaacatggactttttgtggg
accccagaatacgtggccccagagatcatcctgaacaaaggccatgacatttctgctgac
tactggtcactagggattctgatgtatgagcttctgactggcagcccacctttctcaggc
ccagatcctatgaaaacctacaacatcatactgcgggggattgacatgatagaatttcca
aagaagattgcaaaaaatgctgctaatttaattaaaaaactatgcagggacaacccatca
gaaaggttaggaaatttgaaaaacggagtcaaagacattcaaaaacacaagtggtttgag
ggctttaactgggaaggcttaagaaaaggcaccttgactcctcccataattccgagcgtt
gcgtcgcccacggacacaagcaattttgacagtttccctgaggacagcgacgagccaccg
cctgatgacaactcaggctgggacatagacttctaa

DBGET integrated database retrieval system