KEGG   Rattus norvegicus (rat): 25524
Entry
25524             CDS       T01003                                 

Gene name
Psap
Definition
(RefSeq) prosaposin isoform A preproprotein
  KO
K12382  saposin
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00600  Sphingolipid metabolism
rno04142  Lysosome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    25524 (Psap)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    25524 (Psap)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    25524 (Psap)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   25524 (Psap)
SSDB
Motif
Pfam: SapB_1 SapB_2 SapA
Other DBs
NCBI-GeneID: 25524
NCBI-ProteinID: NP_037145
RGD: 3423
Ensembl: ENSRNOG00000000571
UniProt: P10960 Q6P7A4
Position
20
AA seq 554 aa
MYALALLASLLVTALTSPVQDPKICSGGSAVVCRDVKTAVDCRAVKHCQQMVWSKPTAKS
LPCDICKTVVTEAGNLLKDNATEEEILHYLEKTCAWIHDSSLSASCKEVVDSYLPVILDM
IKGEMSNPGEVCSALNLCQSLQEYLAEQNQRQLESNKIPEVDLARVVAPFMSNIPLLLYP
QDRPRSQPQPKANEDVCQDCMKLVTDIQTAVRTNSSFVQGLVDHVKEDCDRLGPGVSDIC
KNYVDQYSEVAVQMMMHMQPKEICVMVGFCDEVKRVPMRTLVPATEAIKNILPALELTDP
YEQDVIQAQNVIFCQVCQLVMRKLSELIINNATEELLIKGLSKACSLLPAPASTKCQEVL
VTFGPSLLDVLMHEVNPNFLCGVISLCSANPNLVGTLEQPAAAIVSALPKEPAPPKQPEE
PKQSALRAHVPPQKNGGFCEVCKKLVIYLEHNLEKNSTKEEILAALEKGCSFLPDPYQKQ
CDEFVAEYEPLLLEILVEVMDPSFVCSKIGVCPSAYKLLLGTEKCVWGPGYWCQNMETAA
RCNAVDHCKRHVWN
NT seq 1665 nt   +upstreamnt  +downstreamnt
atgtatgctctcgctctcctcgccagccttctggtcaccgctctgaccagccctgtccag
gacccgaagatctgctctgggggctcagcagtagtgtgcagagatgtgaagacggcggtg
gactgtagggctgtgaagcactgccagcagatggtctggagcaagcccacagcaaaatcc
cttccttgtgacatatgcaaaacggttgtcaccgaagctgggaacttgctgaaagataat
gctactgaggaggagatcctccattacctggagaagacctgtgcgtggattcatgactcc
agcctgtcagcctcttgcaaggaggtggttgactcttacctgcctgtcatcctggacatg
attaagggggagatgagcaaccccggggaagtgtgctctgcgctcaacctctgccagtcc
cttcaggagtacttggccgagcaaaaccagagacagctggagtccaacaagatcccggag
gtggacctggcccgcgtggttgcccccttcatgtccaacatccctctcctgctgtaccct
caggatcggcctcgcagccagccgcagcccaaggctaacgaggacgtctgccaggactgt
atgaagttggtgactgacatccagactgctgtgaggaccaactccagctttgtccagggc
ttggtggaccacgtcaaggaggattgtgaccgcctcgggccaggcgtgtctgacatatgc
aagaactatgttgaccagtattctgaggtcgccgtccagatgatgatgcacatgcaaccc
aaggaaatctgtgtgatggttggcttctgtgatgaggtcaagagagtgccaatgaggact
ctggtccccgccactgaggccatcaagaatatcctccctgccctggagctgacggacccc
tatgagcaggatgtgatccaggcccaaaatgtgattttctgccaagtttgtcagcttgtg
atgcgcaagttgtctgaactgattatcaacaatgccactgaggaacttctaattaaaggt
ttgagtaaagcctgctccctgctccctgctcctgcttcaaccaagtgccaggaagtgctg
gtaacatttggcccctctctgttggacgtcctcatgcatgaggtgaacccgaactttctg
tgcggtgtgatcagcctctgttctgccaacccgaatttggtggggacccttgaacaacct
gcagcagccattgtatctgcactgcccaaagagcctgcaccgccaaaacagcctgaagag
cccaagcagtctgcattgcgcgcccatgtgcctcctcagaagaacggggggttctgtgag
gtgtgcaagaagctggtcatctatttggaacataacctggagaaaaacagcaccaaggag
gagatcctggctgcacttgagaagggctgcagcttcctgccagacccttaccagaagcag
tgtgatgaatttgtggctgagtatgagcccttactgctggaaatccttgtggaggtgatg
gatccttcctttgtgtgctcgaaaattggagtctgcccttctgcctataagctgctgctg
ggaaccgagaagtgtgtctggggcccaggctactggtgtcagaacatggagactgctgcc
cgatgcaatgctgtcgatcattgcaaacgccatgtgtggaactag

KEGG   Rattus norvegicus (rat): 289720
Entry
289720            CDS       T01003                                 

Gene name
Psapl1
Definition
(RefSeq) proactivator polypeptide-like 1 precursor
  KO
K12382  saposin
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00600  Sphingolipid metabolism
rno04142  Lysosome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    289720 (Psapl1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    289720 (Psapl1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    289720 (Psapl1)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   289720 (Psapl1)
SSDB
Motif
Pfam: SapA SapB_2 SapB_1 Histidinol_dh
Other DBs
NCBI-GeneID: 289720
NCBI-ProteinID: NP_001138322
RGD: 1307368
Ensembl: ENSRNOG00000006845
UniProt: M0R3X1
Position
14
AA seq 527 aa
MNIMLCVLILWSGLLGATKASPISVPHECAKGSEVWCQDLQAAARCRAVRHCQSAVWSKP
TVKSLPCSVCQDVAAAASNGVNPDAKESDILASVMKTCEWLPSQESSAKCKWMVDNHSAA
VLVMLRGAPGTALASVCTALTLCEPLQRHLAVATSERPLTQEDANEVMAPFLSNGALTFH
PSQMPVGAVCHDCVQLISRLQSALESNLTLAEVTVQNQCQSMGPGLAALCENYVHWQFVP
AKQALQTLPPQEVCRKGGFCEEQRESAHWLAQVAAVDGVPSLEMELPKKNELQMQLGLTC
DVCLNVVQELDKWLETNSTEALISHALERVCSIMPESLVQQCITLVDTYGPNLVQLVSKV
TPEKVCETIRLCGSKRQARSISRVATTTPPLLMDEENQGSFCQGCKRLLGVSSQNLDRKS
TKRDILNAFKGGCRILPLPYVLQCNRFVAEYEPVLIESLRFMMNPTDLCKKMGACHGPKV
PLLGTDQCVMGPRFWCKSPEAAEMCDALEHCQRLVWKKPISRTNEQP
NT seq 1584 nt   +upstreamnt  +downstreamnt
atgaacattatgctgtgtgttctgattctctggtccggtctcctgggggccaccaaggcc
agccccatctcggtcccccacgagtgtgccaagggttcggaggtatggtgtcaggacctg
caggcagctgcaaggtgtcgggccgtgaggcactgccagagtgctgtctggagcaagcct
acagtcaagtccctgccctgcagtgtgtgccaggatgtagccgccgctgctagtaatggg
gtgaacccggatgctaaagagtcggacattttggcatcggtaatgaagacctgtgagtgg
cttccaagccaggagtcttcagctaagtgcaagtggatggtggacaaccacagtgcagct
gtcctggtcatgctccgtggagctccgggcactgccctggcttcggtatgcactgcgctc
acactctgtgaaccgctacagaggcacctagctgtggccacctcggagagaccgctcacc
caggaggatgcaaatgaggtgatggcccccttcttatccaatggggccctgaccttccac
ccatcacagatgcctgtgggtgctgtgtgtcatgactgcgtccagctgatctcccggctg
cagagtgctctagagtcaaacttgaccttggcagaggtaactgtccagaatcagtgtcag
tccatggggcctggcctagctgccctctgcgagaactatgtccactggcaatttgtccct
gctaaacaagcactgcagactctccccccacaggaggtctgcaggaaggggggcttctgc
gaggagcagagagagtctgcccactggctggctcaagtggccgctgtggacggagtcccc
tccctagagatggagctgccgaagaagaacgagttgcagatgcagttgggcctgacatgc
gatgtgtgcttgaacgtggtccaggagctggacaagtggcttgagaccaacagcacagaa
gccctcatcagccacgccctggagcgtgtgtgctccataatgccagagtctctagtccaa
cagtgcatcaccctggtggacacctacggccccaacttggtgcagctcgtgtccaaagtc
accccagagaaagtgtgtgagaccatcaggctgtgtggaagcaaaaggcaggccaggtcc
atctccagggttgcgacaaccacaccacccctgctgatggatgaggaaaaccagggcagc
ttctgccaagggtgcaaaaggcttctgggcgtgtcttcccagaatctagaccgcaagagc
accaagcgggacatcctgaatgccttcaaaggtggctgccggatcttgccgttgccttac
gtgctgcagtgcaaccgttttgtagctgagtatgagcctgtgctcatagagagcctcagg
ttcatgatgaaccccacggacctatgcaagaagatgggggcctgccacggccccaaggtt
ccacttctaggcacagaccagtgcgtcatgggcccccgcttctggtgcaagagcccagag
gccgccgagatgtgtgatgccctggagcactgccagcgccttgtgtggaaaaagcccatc
tccagaaccaatgagcagccatga

DBGET integrated database retrieval system