KEGG   Rattus norvegicus (rat): 25526
Entry
25526             CDS       T01003                                 

Gene name
Ptgds, PH2DISO
Definition
(RefSeq) prostaglandin D2 synthase
  KO
K01830  prostaglandin-H2 D-isomerase [EC:5.3.99.2]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00590  Arachidonic acid metabolism
rno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    25526 (Ptgds)
Enzymes [BR:rno01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.99  Other intramolecular oxidoreductases
    5.3.99.2  prostaglandin-D synthase
     25526 (Ptgds)
SSDB
Motif
Pfam: Lipocalin Triabin VDE
Other DBs
NCBI-GeneID: 25526
NCBI-ProteinID: NP_037147
RGD: 3433
Ensembl: ENSRNOG00000015550
UniProt: P22057
Position
3p13
AA seq 189 aa
MAALPMLWTGLVLLGLLGFPQTPAQGHDTVQPNFQQDKFLGRWYSAGLASNSSWFREKKE
LLFMCQTVVAPSTEGGLNLTSTFLRKNQCETKVMVLQPAGVPGQYTYNSPHWGSFHSLSV
VETDYDEYAFLFSKGTKGPGQDFRMATLYSRAQLLKEELKEKFITFSKDQGLTEEDIVFL
PQPDKCIQE
NT seq 570 nt   +upstreamnt  +downstreamnt
atggctgctcttccaatgctgtggaccgggctggtcctcttgggtctcttgggatttcca
cagaccccagcccagggccatgacacagtgcagcccaactttcaacaagacaagttcctg
gggcgctggtacagcgcgggcctcgcctccaattcaagctggttccgggagaagaaagag
ctactgtttatgtgccagacagtggtagctccctccacagaaggcggcctcaacctcacc
tctaccttcctaaggaaaaaccagtgtgagaccaaggtgatggtactgcagccggcaggg
gttcccggacagtacacctacaacagcccccactggggcagcttccactccctctcagtg
gtagaaaccgactacgatgagtacgcgttcctgttcagcaagggcaccaagggcccaggc
caggacttccgcatggccaccctctacagcagagcccagcttctgaaggaggaactgaag
gagaaattcatcacctttagcaaggaccagggcctcacagaggaggacattgttttcctg
ccccaaccggataagtgcattcaagagtaa

DBGET integrated database retrieval system