KEGG   Rattus norvegicus (rat): 25528Help
Entry
25528             CDS       T01003                                 

Gene name
Sirpa, Bit, Ptpns1, SHPS-1
Definition
(RefSeq) signal-regulatory protein alpha
  KO
K06551  signal-regulatory protein alpha/beta1/gamma
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04380  Osteoclast differentiation
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04380 Osteoclast differentiation
    25528 (Sirpa)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:rno04515]
    25528 (Sirpa)
   04090 CD molecules [BR:rno04090]
    25528 (Sirpa)
Cell adhesion molecules [BR:rno04515]
 Immunoglobulin superfamily
  SIRP family
   25528 (Sirpa)
CD molecules [BR:rno04090]
 Proteins
  25528 (Sirpa)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: C1-set Ig_3 ig V-set C2-set_2 I-set Ig_2 SIT
Motif
Other DBs
NCBI-GeneID: 25528
NCBI-ProteinID: NP_037148
RGD: 3449
Ensembl: ENSRNOG00000004763
UniProt: P97710
Position
3q36
AA seq 509 aa AA seqDB search
MEPAGPAPGRLGPLLFCLLLSASCICAGASGKELKVTQADKSVSVAAGDSATLNCTVSSL
TPVGPIKWFKGEGQNRSPIYSFIGGEHFPRITNVSDATKRNNMDFSICISNVTPEDAGTY
YCVKFQKGIVEPDTEIKSGGGTTLYVLAKPSSPEVSGPDSRGSPGQTVNFTCKSYGFSPR
NITLKWLKNGKELSHLETTISSKSNVSYNISSTVSVKLSPEDIHSRVICEVAHVTLEGRP
LNGTANFSNIIRVSPTLKITQQPLTPASQVNLTCQVQKFYPKALQLNWLENGNLSRTDKP
EHFTDNRDGTYNYTSLFLVNSSAHREDVVFTCQVEHDSQPAITENHTVRAFAHSSSGGSM
ETIPDNNAYYNWNVFIGVGVACALLVVLLMAALYLLRIKQKKAKGSTSSTRLHEPEKNAR
EITQIQDTNDINDITYADLNLPKEKKPAPRVPEPNNHTEYASIETGKLPRPEDTLTYADL
DMVHLNRAQPTPKPEPSFSEYASVQVQRK
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atggagcccgccggcccggcccctggccgcctagggccgctgctgttctgccttctgctc
tccgcctcctgtatctgtgcaggagccagcgggaaagaactgaaggtgactcaggctgac
aaatcagtgtctgttgctgctggagattcggccactctgaactgcactgtgtcctccctg
acgcctgtgggacccattaagtggttcaaaggagaagggcaaaatcggagcccgatctac
agtttcataggaggagaacactttcctcgaattacaaatgtttcagatgctactaagaga
aacaatatggactttagcatctgtatcagtaatgtcaccccagaagatgctggcacctac
tactgtgtgaagttccagaaaggaatagtagagcctgacacagaaattaaatctggaggg
ggaacaacgctctatgtactcgccaaaccttcttcaccggaagtatcgggcccagactcc
aggggctctcctggacagacagtgaacttcacctgcaagtcttacggcttctctccccgg
aatatcaccctgaagtggctcaaaaatgggaaagaactctcccatttggagaccaccatc
tccagtaaaagcaatgtctcctacaacatctccagcacagtcagcgtgaaactaagcccc
gaggacattcattctcgggtcatctgcgaggtagcccacgtcaccttggaaggacgcccg
cttaatgggaccgctaacttttctaacatcatccgagtttcacccaccttgaagatcacc
caacagcccctgacgcccgcgagccaggtgaacctcacctgccaggtgcagaagttctac
cccaaggctctccagctgaactggctggagaatggaaacttatcacggacggacaagccc
gagcatttcacagacaacagggatgggacctataattacacaagcctgttcctggtgaac
tcatctgctcacagagaggatgtggtattcacgtgccaggtggagcatgacagtcagcca
gcgatcaccgaaaaccataccgtgcgggcatttgcccactcgagtagtggaggcagcatg
gaaaccatccctgataataatgcttactacaactggaacgtcttcatcggtgtgggtgtg
gcgtgtgctttgctagtagtcctgctgatggctgccctctacctcctccgaatcaaacag
aagaaagccaagggctcaacttcttccacacggttgcacgagcccgagaagaatgccagg
gaaataacccagatccaggacacaaatgacatcaacgacatcacatacgcagacctgaat
ctgcccaaagagaagaagcccgccccccgggtccccgagcccaacaaccacacagaatat
gcaagcattgagacaggcaaactgcctaggccagaggataccctcacctatgctgacctg
gacatggtccacctcaaccgggcacagccaacccccaagcctgagccatccttctcagag
tatgccagtgtccaagtccagaggaagtga

DBGET integrated database retrieval system