KEGG   Rattus norvegicus (rat): 25529Help
Entry
25529             CDS       T01003                                 

Gene name
Ptprs, Larptp2, Ptprd, Ptpsigma, Ptpsigma., Rptpd
Definition
(RefSeq) protein tyrosine phosphatase, receptor type, S
  KO
K06778  receptor-type tyrosine-protein phosphatase S [EC:3.1.3.48]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    25529 (Ptprs)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     25529 (Ptprs)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Receptor PTPs
    25529 (Ptprs)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Y_phosphatase fn3 I-set Ig_3 Ig_2 ig Pur_ac_phosph_N DSPc V-set Y_phosphatase3 Interfer-bind PTPlike_phytase Ig_5
Motif
Other DBs
NCBI-GeneID: 25529
NCBI-ProteinID: NP_062013
RGD: 3452
Ensembl: ENSRNOG00000047247
UniProt: Q64605
Position
9q12
AA seq 1863 aa AA seqDB search
MAPTWRPSVVSVVGPVGLFLVLLARGCLAEEPPRFIREPKDQIGVSGGVASFVCQATGDP
KPRVTWNKKGKKVNSQRFETIDFDESSGAVLRIQPLRTPRDENVYECVAQNSVGEITVHA
KLTVLREDQLPPGFPNIDMGPQLKVVERTRTATMLCAASGNPDPEITWFKDFLPVDPSAS
NGRIKQLRSGALQIESSEETDQGKYECVATNSAGVRYSSPANLYVRVRRVAPRFSILPMS
HEIMPGGNVNITCVAVGSPMPYVKWMQGAEDLTPEDDMPVGRNVLELTDVKDSANYTCVA
MSSLGVIEAVAQITVKSLPKAPGTPVVTENTATSITVTWDSGNPDPVSYYVIEYKSKSQD
GPYQIKEDITTTRYSIGGLSPNSEYEIWVSAVNSIGQGPPSESVVTRTGEQAPASAPRNV
QARMLSATTMIVQWEEPVEPNGLIRGYRVYYTMEPEHPVGNWQKHNVDDSLLTTVGSLLE
DETYTVRVLAFTSVGDGPLSDPIQVKTQQGVPGQPMNLRAEAKSETSIGLSWSAPRQESV
IKYELLFREGDRGREVGRTFDPTTAFVVEDLKPNTEYAFRLAARSPQGLGAFTAVVCQRT
LQAKPSAPPQDVKCTSLRSTAILILLEALEKWTEYRVTAVAYTEVGPGPESSPVVVRTDE
DVPSAPPRKVEAEALNATAIRVLWRSPTPGRQHGQIRGYQVHYVRMEGTEARGPPRIKDI
MLADAQEMVITNLQPETAYSITVAAYTMKGDGARSKPKVVVTKGAVLGRPTLSVQQTPEG
SLLARWEPPADAAEDPVLGYRLQFGREDAAPATLELAAWERRFAAPAHKGATYVFRLAAR
GRAGLGEEASAALSIPEDAPRGFPQILGPAGNVSAGSVILRWLPPVPAEGNGAIIKYTVS
VREAGTPGPATETELAAAAQPGAETALTLQGLRPETAYELRVRAHTRRGPGPFSPPLRYR
LARDPVSPKNFKVKMIMKTSVLLSWEFPDNYNSPTPYKIQYNGLTLDVDGRTTKKLITHL
KPHTFYNFVLTNRGSSLGGLQQTVTARTAFNMLSGKPSVAPKPDNDGSIVVYLPDGQSPV
TVQNYFIVMVPLRKSRGGQFPILLGSPEDMDLEELIQDLSRLQRRSLRHSRQLEVPRPYI
AARFSILPAVFHPGNQKQYGGFDNRGLEPGHRYVLFVLAVLQKNEPTFAASPFSDPFQLD
NPDPQPIVDGEEGLIWVIGPVLAVVFIICIVIAILLYKNKPDSKRKDSEPRTKCLLNNAD
LAPHHPKDPVEMRRINFQTPGMLSHPPIPITDMAEHMERLKANDSLKLSQEYESIDPGQQ
FTWEHSNLEANKPKNRYANVIAYDHSRVILQPLEGIMGSDYINANYVDGYRRQNAYIATQ
GPLPETFGDFWRMVWEQRSATVVMMTRLEEKSRVKCDQYWPNRGTETYGFIQVTLLDTME
LATFCVRTFSLHKNGSSEKREVRHFQFTAWPDHGVPEYPTPFLAFLRRVKTCNPPDAGPV
VVHCSAGVGRTGCFIVIDAMLERIRTEKTVDVYGHVTLMRSQRNYMVQTEDQYSFIHEAL
LEAVGCGNTEVPARSLYTYIQKLAQVEPGEHVTGMELEFKRLASSKAHTSRFITASLPCN
KFKNRLVNILPYESSRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFW
RALWENNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKV
TDARDGQSRTVRQFQFTDWPEQGAPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVG
RTGVFITLSIVLERMRYEGVVDIFQTVKVLRTQRPAMVQTEDEYQFCFQAALEYLGSFDH
YAT
NT seq 5592 nt NT seq  +upstreamnt  +downstreamnt
atggcgcccacctggagacccagcgtggtgtctgtggtgggtcctgtggggctcttcctt
gtactgctggccagagggtgcttggctgaagagccacccagatttatcagagagcccaag
gatcagattggtgtgtcaggaggcgtggcctccttcgtgtgccaggccacaggtgaccct
aagccacgggtgacctggaacaagaagggcaagaaagtgaactcacagcgctttgagacc
attgactttgacgagagctcgggggccgtgctgaggatccagccacttcggacaccccgg
gatgagaacgtgtacgagtgtgtggcccagaactcggtgggggagatcacagttcatgcg
aagctcaccgtcctgcgagaggaccagctgcctcctggcttccccaacattgacatgggc
ccccagttgaaggttgtagagcgcacacgcacagccaccatgctctgtgctgccagcgga
aaccctgaccctgagatcacctggttcaaggacttcctgcctgtggaccccagtgccagc
aatgggcggatcaagcagcttcggtcaggtgccctgcagattgagagcagcgaggagaca
gaccagggcaagtacgagtgtgtggccaccaacagcgctggggtgcgctactcatcacct
gccaacctctacgtgcgagtccgccgtgtggccccccgcttctccatcctgcccatgagc
cacgagatcatgcccggtgggaatgtgaatatcacttgtgtggctgtgggctcacccatg
ccctacgtgaagtggatgcagggggcagaggacctgacgcctgaggatgacatgcccgtg
ggtcggaatgtcctcgaactcacggatgtcaaagactcagccaactatacttgtgtggcc
atgtccagcctgggagtgatcgaggccgttgctcagatcactgtaaaatctctccccaaa
gcccctgggactcccgtggtgacggagaacactgctaccagtatcactgtcacatgggac
tcaggcaatcctgaccctgtgtcctactacgtaattgagtataaatccaaaagccaggat
gggccgtatcagatcaaagaagacatcaccaccacgcgctacagcatcggcggcctgagc
cccaactctgagtatgagatctgggtgtcagctgtcaactccatcggccagggccccccc
agtgagtcggtggtgacccgcacaggcgagcaggcaccagccagtgctcccaggaatgtt
caggcgcgcatgctcagtgccaccaccatgattgtgcagtgggaggagcccgtggagccc
aatggcctgatccgtggctaccgcgtctactacaccatggagcccgagcatccggtgggc
aactggcagaagcacaatgtggacgacagtcttctgaccactgtgggcagcctgctagag
gatgagacctacactgtgagagtgctcgccttcacatcggtgggcgatgggccactgtca
gaccccatccaggtcaagacccagcagggagtgcccggccagcccatgaacttgcgggct
gaggccaagtcagagaccagcattgggctctcgtggagtgcaccacggcaggagagtgtc
attaagtatgaactgctcttccgggagggcgaccgaggccgagaggtggggcgaaccttc
gacccaaccacagcctttgtggtggaggacctcaagcccaatacggagtacgcgttccgg
ctggcggctcgctcgccgcagggcctgggcgccttcaccgcggttgtgtgccagcgcaca
ctgcaggccaaaccgtcagccccccctcaagacgttaagtgcaccagcttgcgctccacg
gccatattgatccttctggaagctttggagaaatggacggagtaccgtgtcaccgccgtg
gcttacacagaggtgggaccagggcccgagagctcgcccgtggtcgtccgcaccgatgag
gacgtgcccagcgcgcccccgcggaaggtggaggcggaggcgctcaacgccacggctatc
cgagtgctgtggcgctcgcccacgcccggcaggcagcacgggcagatccgcggctaccag
gtccactatgtgcgcatggagggcaccgaggcccgcgggccaccgcgcatcaaggacatc
atgctggcggatgcccaggaaatggtgatcacaaacctccagcctgagactgcttactct
atcacagtagccgcgtataccatgaaaggcgatggcgctcgcagcaaaccgaaggtggtg
gtgaccaagggagcagtgctgggccgccccaccctgtcggtgcagcagacccccgagggc
agcctgctggcgcgctgggagccccccgcggacgcggctgaggacccagtgcttggctac
cgcctgcagtttgggcgcgaagacgcggccccggccacgttggaactggcggcgtgggag
cggcggttcgcggcgcctgcacacaagggcgccacctatgtgtttcggctggcggcgcgg
ggccgcgcggggctgggcgaggaggcctcggcggcgctgagcatccctgaggacgctccg
cgtggcttcccgcagatcctgggccccgcgggcaacgtgtccgcgggctccgtaatactg
cgctggctgccacccgtgcccgccgagggcaacggcgccatcatcaagtacacggtgtcc
gtgcgggaggccggcaccccagggcccgcgacagagaccgaactggcggcggcggcccag
ccgggggccgagacagcgctcacactacaggggctgcggccggagacggcctacgagctg
cgcgtgcgcgcgcacacgcgtcggggccccggccccttctcacccccgctgcgatacagg
cttgcgcgggacccagtctcccccaagaacttcaaggtgaagatgatcatgaaaacttca
gtgctgctaagctgggagttccctgacaactataactcacccacgccctacaagatccag
tacaatggactcacactggacgtggatggccgcactaccaagaagctgatcacgcacctc
aagccacacaccttctataacttcgtgctcaccaaccgtggcagcagcctgggaggcctg
cagcagacggtcaccgccaggaccgccttcaacatgctcagtggcaagcctagtgtcgcc
ccaaagcctgacaacgatggttccattgtggtctacctgcctgatggccagagtcccgtg
acagtgcagaactacttcattgtgatggtcccacttcggaagtctcgtggtggccagttc
cctatcctactaggtagtccagaggacatggatctggaggagctcatccaggacctctcc
cggctgcagaggcgcagcctgcgccactcaagacagctggaggtgcctcggccttacatc
gccgctcggttctccatcctgccagctgtcttccatcctgggaaccagaagcaatatggt
ggctttgacaacaggggcttggagccaggccaccgttatgtcctctttgtacttgctgtg
ctgcagaagaatgagcctacatttgcagccagtcccttctcagaccccttccaactggac
aacccagacccgcagcccattgtggatggcgaggagggcctcatctgggtgatcgggccc
gtgctggccgtggtcttcatcatctgcatcgtaattgccatcctgctgtacaagaacaag
cctgacagcaaacgcaaggactcagagccccgcaccaaatgcttattgaacaatgcagac
ctcgccccccatcaccccaaggaccctgtggaaatgcgacgtatcaacttccagacgcca
ggtatgctcagccacccgcccattcccatcacagacatggctgaacacatggagagactc
aaagccaacgacagcctcaagctctcccaggagtatgagtccatcgaccctggccagcag
ttcacttgggaacattcgaacctggaggccaacaagccaaagaaccgatacgccaatgtc
atcgcctatgaccattcacgagtcatcctgcagcctttagaaggcatcatgggtagtgat
tacatcaatgccaactatgtggacggctatcggcggcagaacgcatacatcgccacgcag
gggcccctgcctgagacctttggggacttctggcggatggtgtgggagcagcggtcagcc
actgtggtcatgatgacacggctggaggagaaatcacgggtcaaatgtgaccagtactgg
cctaaccgaggcaccgagacatacggcttcatccaggtcaccctactagatactatggag
ctggccaccttctgtgtcaggaccttttctctacacaagaatggctctagtgagaagcgt
gaggtacgacattttcagttcacagcatggcctgaccacggggtacccgagtaccccaca
cccttcctggcgtttctgcgcagagtcaagacctgcaacccgcctgacgctggcccagtt
gtggtccactgcagcgcgggtgtggggcgtactggctgcttcattgtaattgatgccatg
ttggagcgcatcagaacagagaagacggtggatgtgtacggacacgtgacactcatgcgg
tcacagcgcaactacatggtgcagacagaggatcagtatagcttcatccacgaggcactg
ctggaggctgtgggctgtggcaataccgaggtccccgcgcgcagcctctacacctatatc
cagaagctggcccaggtggagcctggcgagcatgtcacaggaatggagcttgagttcaag
aggcttgccagctccaaggcacacacttcgagattcatcactgccagcctgccttgcaac
aagtttaagaaccgcctggtgaacatcctgccgtacgagagctcgcgtgtctgcctgcag
cccattcgtggtgtcgagggctctgactacatcaatgccagcttcatcgacggctacaga
cagcagaaagcctacattgcaacgcagggtccactggcagagaccacagaggacttctgg
cgtgccctgtgggagaacaactccactattgtggtaatgctcaccaagctccgcgagatg
ggccgggagaagtgccaccagtactggccagctgaacgctctgcccgctaccagtacttt
gtggttgacccgatggcagagtataacatgccacagtacattctgcgtgagtttaaggtc
acagatgcccgggatggccagtcccggaccgtccgacagttccagttcacggactggcca
gagcagggtgcacccaagtcaggggaaggcttcattgacttcatcggccaagtgcataag
accaaggagcagtttggccaggatggccccatctcggtgcactgtagtgctggagtgggc
aggaccggagtattcatcactctgagcatcgtgctggagcgaatgcgctacgagggggtg
gtggacattttccagacagtgaaggtgcttcggacccagcggcctgccatggtgcagaca
gaggatgagtaccagttctgcttccaggcggcgttggaatacctgggcagctttgatcat
tatgcaacataa

DBGET integrated database retrieval system