KEGG   Rattus norvegicus (rat): 25533
Entry
25533             CDS       T01003                                 

Gene name
Rabggtb
Definition
(RefSeq) Rab geranylgeranyltransferase, beta subunit
  KO
K05956  geranylgeranyl transferase type-2 subunit beta [EC:2.5.1.60]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:rno01006]
    25533 (Rabggtb)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    25533 (Rabggtb)
Enzymes [BR:rno01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.60  protein geranylgeranyltransferase type II
     25533 (Rabggtb)
Prenyltransferases [BR:rno01006]
 Protein prenylation
  Rab geranylgeranyltransferase
   25533 (Rabggtb)
Membrane trafficking [BR:rno04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    25533 (Rabggtb)
 Endosome - Lysosome transport
  Rab GTPases and associated proteins
    25533 (Rabggtb)
SSDB
Motif
Pfam: Prenyltrans SQHop_cyclase_C
Other DBs
NCBI-GeneID: 25533
NCBI-ProteinID: NP_619715
RGD: 3530
Ensembl: ENSRNOG00000009992
UniProt: Q08603
Structure
PDB: 

Position
2q45
AA seq 331 aa
MGTQQKDVTIKSDAPDTLLLEKHADYIASYGSKKDDYEYCMSEYLRMSGVYWGLTVMDLM
GQLHRMNKEEILVFIKSCQHECGGVSASIGHDPHLLYTLSAVQILTLYDSIHVINVDKVV
AYVQSLQKEDGSFAGDIWGEIDTRFSFCAVATLALLGKLDAINVEKAIEFVLSCMNFDGG
FGCRPGSESHAGQIYCCTGFLAITSQLHQVNSDLLGWWLCERQLPSGGLNGRPEKLPDVC
YSWWVLASLKIIGRLHWIDREKLRSFILACQDEETGGFADRPGDMVDPFHTLFGIAGLSL
LGEEQIKPVSPVFCMPEEVLQRVNVQPELVS
NT seq 996 nt   +upstreamnt  +downstreamnt
atgggcacacagcagaaggacgtcaccatcaagtcagatgcgcctgacaccctgctgctc
gagaagcatgctgattatatcgcctcgtacggctcaaagaaagatgattatgaatactgc
atgtccgaatacttgagaatgagcggcgtctactggggcctgacagtgatggacctcatg
gggcagcttcatcggatgaataaagaggagatactggtgtttatcaagtcgtgccagcat
gagtgtgggggagtcagtgccagcatcgggcacgacccccaccttctctacacgctcagt
gctgtccagattctcactctgtatgatagcatccatgtaatcaacgtagacaaagtggta
gcctatgttcagagtctacagaaagaagatggttcctttgctggagacatctggggagaa
atcgatacaagattctcattttgtgcagtggcaactttggctctcttgggcaaacttgat
gctattaatgtggaaaaggccattgaatttgttttgtcctgtatgaactttgatggtgga
tttgggtgcagaccaggctctgaatctcacgccggacagatctattgttgcacaggattc
ctggccataactagtcagttgcatcaagtgaactccgacctacttggttggtggctttgt
gaacgacagttgccctctggcggactcaatggaagacccgagaagttaccagatgtgtgc
tattcctggtgggtgttggcctccttaaagataatcgggaggcttcattggattgacaga
gaaaagcttcgaagcttcatcttggcatgtcaagatgaagagacaggagggtttgcagac
aggccaggagacatggtggatccctttcacaccttgtttggcattgctggattgtcactt
ctgggggaagagcagatcaagcctgtcagccctgtcttttgcatgcctgaagaagtgcta
cagagggtgaatgtccagcctgaactagtgagctag

DBGET integrated database retrieval system