KEGG   Rattus norvegicus (rat): 25537Help
Entry
25537             CDS       T01003                                 

Gene name
Rock2, ROCK-II, ROK
Definition
(RefSeq) Rho-associated coiled-coil containing protein kinase 2
  KO
K17388  Rho-associated protein kinase 2 [EC:2.7.11.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04022  cGMP-PKG signaling pathway
rno04024  cAMP signaling pathway
rno04062  Chemokine signaling pathway
rno04071  Sphingolipid signaling pathway
rno04270  Vascular smooth muscle contraction
rno04310  Wnt signaling pathway
rno04360  Axon guidance
rno04510  Focal adhesion
rno04530  Tight junction
rno04611  Platelet activation
rno04670  Leukocyte transendothelial migration
rno04810  Regulation of actin cytoskeleton
rno04921  Oxytocin signaling pathway
rno05132  Salmonella infection
rno05135  Yersinia infection
rno05163  Human cytomegalovirus infection
rno05200  Pathways in cancer
rno05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    25537 (Rock2)
   04071 Sphingolipid signaling pathway
    25537 (Rock2)
   04024 cAMP signaling pathway
    25537 (Rock2)
   04022 cGMP-PKG signaling pathway
    25537 (Rock2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    25537 (Rock2)
   04530 Tight junction
    25537 (Rock2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    25537 (Rock2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    25537 (Rock2)
   04670 Leukocyte transendothelial migration
    25537 (Rock2)
   04062 Chemokine signaling pathway
    25537 (Rock2)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    25537 (Rock2)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    25537 (Rock2)
  09158 Development and regeneration
   04360 Axon guidance
    25537 (Rock2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    25537 (Rock2)
   05205 Proteoglycans in cancer
    25537 (Rock2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    25537 (Rock2)
   05135 Yersinia infection
    25537 (Rock2)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    25537 (Rock2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    25537 (Rock2)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    25537 (Rock2)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     25537 (Rock2)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: AGC group
  DMPK family [OT]
   25537 (Rock2)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    25537 (Rock2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Rho_Binding PH C1_1 APH
Motif
Other DBs
NCBI-GeneID: 25537
NCBI-ProteinID: NP_037154
RGD: 3590
Ensembl: ENSRNOG00000004496
UniProt: Q62868 A0A0G2K5N6
Structure
PDB: 

Position
6q16
AA seq 1388 aa AA seqDB search
MSRPPPTGKMPGAPEAAPGDGAGAGRQRKLEALIRDPRSPINVESLLDGLNSLVLDLDFP
ALRKNKNIDNFLNRYEKIVKKIRGLQMKAEDYDVVKVIGRGAFGEVQLVRHKASQKVYAM
KLLSKFEMIKRSDSAFFWEERDIMAFANSPWVVQLFCAFQDDRYLYMVMEYMPGGDLVNL
MSNYDVPEKWAKFYTAEVVLALDAIHSMGLIHRDVKPDNMLLDKHGHLKLADFGTCMKMD
ETGMVHCDTAVGTPDYISPEVLKSQGGDGYYGRECDWWSVGVFLFEMLVGDTPFYADSLV
GTYSKIMDHKNSLCFPEDTEISKHAKNLICAFLTDREVRLGRNGVEEIKQHPFFKNDQWN
WDNIRETAAPVVPELSSDIDSSNFDDIEDDKGDVETFPIPKAFVGNQLPFIGFTYFRENL
LLSDSPPCRENDAIQTRKSEESQEIQKKLYALEEHLSSEVQAKEELEQKCKSINTRLEKT
AKELEEEITFRKNVESTLRQLEREKALLQHKNAEYQRKADHEADKKRNLENDVNSLKDQL
EDLKKRNQSSQISTEKVNQLQKQLDEANALLRTESDTAARLRKTQAESSKQIQQLESNNR
DLQDKNCLLETAKLKLEKEFINLQSALESERRDRTHGSEIINDLQGRISGLEEDLKTGKT
LLAKVELEKRQLQEKLTDLEKEKSNMEIDMTYQLKVIQQSLEQEEAEHKTTKARLADKNK
IYESIEEAKSEAMKEMEKKLLEERSLKQKVENLLLEAEKRCSILDCDLKQSQQKLNELLK
QKDVLNEDVRNLTLKIEQETQKRCLMQNDLKMQTQQVNTLKMSEKQIKQENNHLMEMKMN
LEKQNAELRKERQDADGQMKELQDQLEAEQYFSTLYKTQVRELKEENEEKTKLCKELQQK
KQDLQDERDSLAAQLEITLTKADSEQLARSIAEEQYSDLEKEKIMKELEIKEMMARHKQE
LTEKDATIASLEETNRTLTSDVANLANEKEELNNKLKDTQEQLSKLKDEEISAAAIKAQF
EKQLLTERTLKTQAVNKLAEIMNRKEPVKRGSDTDVRRKEKENRKLHMELKSEREKLTQQ
MIKYQKELNEMQAQIAEESQIRIELQMTLDSKDSDIEQLRSQLQALHIGMDSSSIGSGPG
DAEPDDGFPESRLEGWLSLPVRNNTKKFGWVKKYVIVSSKKILFYDSEQDKEQSNPYMVL
DIDKLFHVRPVTQTDVYRADAKEIPRIFQILYANEGESKKEPEFPVEPVGEKSNYICHKG
HEFIPTLYHFPTNCEACMKPLWHMFKPPPALECRRCHIKCHKDHMDKKEEIIAPCKVYYD
ISSAKNLLLLANSTEEQQKWVSRLVKKIPKKPPAPDPFARSSPRTSMKIQQNQSIRRPSR
QLAPNKPS
NT seq 4167 nt NT seq  +upstreamnt  +downstreamnt
atgagccggcccccgccgacggggaaaatgcccggcgcccccgaggccgcgccgggggac
ggggcgggcgcgggtcgtcagaggaagctggaggcgctcatccgagaccctcgctcgccc
atcaacgtggaaagcctgctggatggcttaaattccttggtccttgatttggattttcct
gctttgaggaaaaataaaaatatagataatttcctaaatagatatgagaaaattgtgaaa
aaaatcagaggtttacagatgaaagcagaagactatgatgttgtaaaagttattggaaga
ggtgcttttggtgaagttcagttggttcgtcataaggcatcacagaaggtttatgcaatg
aagcttcttagtaaatttgaaatgataaaaagatcagattctgcttttttctgggaagaa
agagatattatggcttttgctaacagtccgtgggtggttcagctcttttgtgcctttcaa
gatgacaggtatctgtacatggtgatggagtacatgccaggtggagaccttgttaacctg
atgagcaattatgatgtgcctgagaagtgggccaagttttatactgctgaagtcgtgctt
gcactggatgcaatacactccatgggcttaatacacagagatgtgaagcccgataacatg
ctattggataaacacggacatctaaaattagcagattttggcacatgtatgaaaatggat
gaaacaggcatggtgcattgtgatacagcagttggaactccagactacatatcacctgag
gttctgaaatcacaaggaggtgatggttactatggacgagaatgtgattggtggtctgta
ggtgttttcctttttgagatgttagtaggggacactccattttatgcagattcacttgta
ggaacctacagcaaaattatggatcataaaaattcactgtgttttcctgaagatacagaa
atttctaaacatgcgaagaatctcatatgtgccttcttaacagacagggaggtacgactt
ggaagaaatggggtagaagaaatcaaacagcatcctttctttaagaatgatcagtggaat
tgggataacataagagagacggcagctccagtggtgcctgagctcagcagtgacatagac
agcagcaactttgatgacattgaggatgacaaaggcgatgtagagaccttcccgattcct
aaagcttttgtgggaaatcagctgccttttataggatttacctactttagagaaaatttg
ttactaagtgattctccaccttgtagagaaaatgatgcaatacaaacaaggaaaagtgaa
gaaagtcaggagattcagaaaaaattatatgcactagaagaacaccttagcagtgaggta
caagccaaggaggaactggaacagaagtgcaagtctattaatactcgtctagagaaaaca
gcaaaggaactagaagaagagattacctttaggaaaaatgtggaatcaacattaagacag
ctagaaagagaaaaggcccttcttcagcacaaaaatgcagaatatcaacggaaagctgat
catgaagctgacaagaaacggaatttggaaaatgatgttaacagcttaaaagatcaactt
gaagatctgaagaaaagaaaccagagctctcagatatccactgagaaggtcaatcagctc
cagaaacaactggatgaagctaatgctttgctaagaacagagtctgatactgcagcacgg
ttaagaaaaacccaggcagaaagttccaaacagattcagcagctggaatctaacaataga
gatctacaagataaaaactgcctgcttgaaactgccaagttaaaacttgagaaggaattt
atcaatcttcagtcagctctagaatctgaaagaagggaccggacccatggatcagagata
attaatgatttacaaggtagaatatctgggttggaagaagatttgaagactggcaaaacc
ttactagcaaaagtagagctggagaagagacagctgcaggagaagctcactgacttagag
aaggaaaagagcaacatggaaatagatatgacatatcaactgaaagttatacagcagagt
ttagaacaagaagaagctgaacacaagaccacaaaagcacgactagcggataaaaataag
atctatgaatccattgaagaagctaaatcagaagccatgaaagaaatggagaagaagctg
ttggaagagaggtctttaaagcagaaagtggagaacctactcctggaagccgagaagaga
tgttctatattggattgtgacctcaaacagtctcagcagaaactgaatgagctgctgaag
cagaaagatgtgctgaatgaggatgttagaaatttgacattaaaaatagagcaggaaact
cagaagcgttgtcttatgcaaaatgacctgaagatgcagacccagcaagttaacacccta
aaaatgtcagaaaagcaaataaaacaagaaaataatcatcttatggaaatgaaaatgaac
ttggaaaagcaaaatgctgaacttcgaaaagagcggcaggatgcagatgggcagatgaag
gaactgcaagaccaacttgaagcagagcagtatttctcaaccctctataaaacacaagtt
agagaacttaaagaagaaaatgaagagaaaactaaactttgtaaagagttgcagcagaaa
aagcaggatttacaggatgaaagagactccttggctgcccagctggagatcaccctcacc
aaagcagactctgagcagctggctcgctccattgctgaggagcaatactctgacttggaa
aaagagaagatcatgaaagagctggaaatcaaagagatgatggctagacacaaacaagag
cttactgaaaaggacgctacaattgcatcccttgaagaaacaaatagaacactaactagt
gatgttgcaaatcttgcaaacgagaaagaagaactaaacaacaagttgaaagatacccaa
gaacaactgtcaaagttgaaagatgaagagatcagtgcagcggctattaaagcacagttt
gagaagcagctgctgactgagcgaacactcaagactcaagctgtgaataagttggcagag
atcatgaatcgaaaagaacctgtcaagcgtggtagtgacacagatgtgcgaagaaaagaa
aaggaaaacagaaaattacatatggagcttaagtctgaacgtgaaaaattgacacaacag
atgatcaaatatcagaaagaactgaatgaaatgcaggctcaaatagctgaagagagccaa
attcgaatagaactgcagatgaccctggacagtaaagacagtgacattgaacagcttcgg
tcgcagctccaggccttgcatattggtatggacagttccagtataggcagtggaccaggg
gatgctgagcctgatgacggatttccagaatcacgattagaaggatggctgtcgttgcct
gtgcggaacaacactaaaaagtttggatgggttaagaagtatgtgattgtaagcagcaag
aagattcttttctatgatagtgaacaagataaagagcagtctaacccttacatggtgtta
gacatagacaagctatttcatgtccgacctgttactcagacagatgtatacagagcagat
gctaaagaaattccaaggatatttcagatcctgtatgccaatgaaggagaaagtaaaaag
gaaccagaatttccagtggaaccagtgggagaaaaatctaattatatttgccacaaagga
catgagtttattcctactctttatcacttcccaaccaactgtgaggcctgtatgaagcca
ctgtggcacatgtttaaacctcctcctgctctagagtgccgtagatgccacattaaatgt
cataaagatcacatggacaaaaaggaagagatcatagccccctgcaaagtttattatgat
atatcatcggcaaagaatctgttgttattagcaaattcaacggaagaacagcagaaatgg
gttagtcggttggtgaaaaagatacctaaaaagcctccagctccagacccttttgcccga
tcatcccctagaacctcaatgaaaatacaacaaaaccagtccattcggcggcccagtcga
cagcttgctccaaacaaaccaagctaa

DBGET integrated database retrieval system