KEGG   Rattus norvegicus (rat): 25542
Entry
25542             CDS       T01003                                 

Gene name
Ccl3
Definition
(RefSeq) C-C motif chemokine 3 precursor
  KO
K05408  C-C motif chemokine 3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04061  Viral protein interaction with cytokine and cytokine receptor
rno04062  Chemokine signaling pathway
rno04620  Toll-like receptor signaling pathway
rno05142  Chagas disease
rno05163  Human cytomegalovirus infection
rno05323  Rheumatoid arthritis
rno05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    25542 (Ccl3)
   04061 Viral protein interaction with cytokine and cytokine receptor
    25542 (Ccl3)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    25542 (Ccl3)
   04062 Chemokine signaling pathway
    25542 (Ccl3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    25542 (Ccl3)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    25542 (Ccl3)
  09163 Immune disease
   05323 Rheumatoid arthritis
    25542 (Ccl3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    25542 (Ccl3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    25542 (Ccl3)
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    25542 (Ccl3)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Chemokines
   25542 (Ccl3)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Heparin
  Chemokines
   25542 (Ccl3)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 25542
NCBI-ProteinID: NP_037157
RGD: 3647
Ensembl: ENSRNOG00000011205
Vega: OTTRNOG00000000486
UniProt: P50229
Position
10
AA seq 92 aa
MKVSTAALAVLLCTMALWNEVFSAPYGADTPTACCFSYGRQIPRKFIADYFETSSLCSQP
GVIFLTKRNRQICADPKETWVQEYITELELNA
NT seq 279 nt   +upstreamnt  +downstreamnt
atgaaggtctccaccgctgcccttgctgttcttctctgcaccatggcgctctggaacgaa
gtcttctcagcgccatatggagctgacaccccgactgcctgctgcttctcctatggacgg
caaattccacgaaaattcattgctgactattttgagaccagcagcctttgctcccagccg
ggtgtcattttcctgaccaagagaaaccggcagatctgcgctgaccccaaagagacctgg
gtccaagaatacatcactgagctggaactaaatgcctga

DBGET integrated database retrieval system