KEGG   Rattus norvegicus (rat): 25547
Entry
25547             CDS       T01003                                 

Gene name
St8sia3, Siat8c
Definition
(RefSeq) ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 3
  KO
K06613  alpha-N-acetyl-neuraminate alpha-2,8-sialyltransferase (sialyltransferase 8C) [EC:2.4.99.-]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:rno01003]
    25547 (St8sia3)
Enzymes [BR:rno01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.-  
     25547 (St8sia3)
Glycosyltransferases [BR:rno01003]
 Terminal extension
  Sialyltransferase
   25547 (St8sia3)
SSDB
Motif
Pfam: Glyco_transf_29
Other DBs
NCBI-GeneID: 25547
NCBI-ProteinID: NP_037161
RGD: 3680
Ensembl: ENSRNOG00000018305
UniProt: P97877
Position
18q12.1
AA seq 380 aa
MRNCKMARVASILGLVMLSVALLILSLISYVSLKKENIFTTPKYASPGAPRMYMFHAGFR
SQFALKFLEPSFVPITNFLTHELQEKPSKWTFNRTAFLHQRQEILQHVDVIKNFSLTKNS
VRIGQLIHYDYSSHKYVFSISNNFRSLLPDVSPILNKRYNICAVVGNSGILTGSQCGQEI
DKSDFVFRCNFAPTEAFHKDVGKKTNLTTFNPSILEKYYNNLLTIQDRNNFFLSLKKLDG
AILWIPAFFFHTSATVTRTLVDFFVEHRGQLKVQLAWPGNIMQHVNRYWKNKHLSPKRLS
TGFLMYTLASAICEEIHLYGFWPFGFDPNTREDLPYHYYDKKGTKFTTKWQESHQLPAEF
QLLYRMHGEGLTKLTLSHCA
NT seq 1143 nt   +upstreamnt  +downstreamnt
atgagaaattgcaaaatggcccgagtcgccagtatactagggctggtcatgctcagcgtg
gccctgctgattttatcgcttatcagctacgtgtccctgaaaaaggagaacatcttcacc
actcccaagtacgccagcccgggggcgccccgaatgtacatgttccacgcgggattccgg
tcacagtttgcactgaagtttctagaaccgtcatttgtgcccattacgaattttctcacc
catgaactccaagagaaaccttctaaatggacatttaatcggacagcgtttttacatcaa
aggcaagaaattcttcagcatgtcgatgtaataaaaaatttttctttaaccaagaatagt
gttcggatcggacaactgatacattacgattattccagccataaatatgttttctctatt
agcaataacttccggtccctgctcccagatgtgtcgcccattctgaataagcgttataac
atttgtgctgtggtcggaaacagtggaatcttgacagggagtcagtgtggacaagaaata
gataaatcggattttgtttttcggtgcaattttgccccgacagaggctttccacaaagat
gttggaaagaaaaccaacctcacaactttcaatcctagcatcttggaaaaatattacaac
aaccttttaaccatccaggaccgtaacaacttcttcctcagtttaaaaaagctcgacggg
gccattctctggatccccgcatttttcttccacacttctgcgactgtaaccagaacctta
gtggattttttcgttgagcacagaggtcagttaaaggtccagttggcttggcctggaaat
atcatgcaacatgtcaacaggtactggaaaaacaaacacttgtcacccaaacgactgagc
acaggtttcctaatgtacacccttgcatctgcaatatgtgaagagatccacttgtacggt
ttctggcctttcggatttgaccccaacaccagggaggatctgccctaccactactatgac
aaaaaaggaaccaaatttaccaccaagtggcaggagtctcaccagctgcctgctgagttt
cagctgctctatcgaatgcatggggaagggctcacaaagctcactctgtcacactgtgcc
taa

DBGET integrated database retrieval system