KEGG   Rattus norvegicus (rat): 25548Help
Entry
25548             CDS       T01003                                 

Gene name
Slc34a1, NaPi-2, NaPi2A, Npt2, Slc17a2
Definition
(RefSeq) solute carrier family 34 member 1
  KO
K14683  solute carrier family 34 (sodium-dependent phosphate cotransporter)
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04928  Parathyroid hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    25548 (Slc34a1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    25548 (Slc34a1)
   04147 Exosome [BR:rno04147]
    25548 (Slc34a1)
Transporters [BR:rno02000]
 Solute Carrier Family (SLC)
  SLC34: Type II Na+-phosphate cotransporter
   25548 (Slc34a1)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   25548 (Slc34a1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Na_Pi_cotrans
Motif
Other DBs
NCBI-GeneID: 25548
NCBI-ProteinID: NP_037162
RGD: 3708
Ensembl: ENSRNOG00000015262
UniProt: Q06496
Position
17p14
AA seq 637 aa AA seqDB search
MMSYSERLGGPAVSPLPVRGRHMVHGAAFAYVPSPQVLHRIPGTTTYAISSLSPVALTEH
SCPYGEVLECHDPLPAKLAQEEEQKPEPRLSQKLAQVGTKLLKVPLMLGFLYLFVCSLDV
LSSAFQLAGGKVAGDIFKDNAILSNPVAGLVVGILVTVLVQSSSTSTSIIVSMVSSGLLE
VSSAIPIIMGSNIGTSVTNTIVALMQAGDRTDFRRAFAGATVHDCFNWLSVLVLLPLEAA
TGYLHHVTGLVVASFNIRGGRDAPDLLKVITEPFTKLIIQLDKSVITSIAVGDESLRNHS
LIRIWCQPETKEASTSMSRVEAIGSLANTTMEKCNHIFVDTGLPDLAVGLILLAGSLVVL
CTCLILLVKMLNSLLKGQVANVIQKVINTDFPAPFTWVTGYFAMVVGASMTFVVQSSSVF
TSAITPLIGLGVISIERAYPLTLGSNIGTTTTAILAALASPREKLSSSFQIALCHFFFNI
SGILLWYPLPCTRLPIRMAKALGKRTAKYRWFAVLYLLVCFLLLPSLVFGISMAGWQAMV
GVGTPFGALLAFVVLVNVLQSRSPGHLPKWLQTWDFLPRWMHSLQPLDGLITRATLCYAR
PEPRSPQLPPRVFLEELPPATPSPRLALPAHHNATRL
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
atgatgtcctacagcgagagattggggggaccggctgtctccccacttccagtccgtggg
agacacatggtgcatggggcagcctttgcttatgtccccagcccacaagtcctgcacagg
attcctgggacaaccacctatgccatctccagtctgagcccggtagccctcacagagcac
agctgtccctatggggaggtcctggaatgtcatgacccgctccctgccaagctggcccag
gaagaggagcaaaagccagagcccaggctgtcccagaagcttgcccaggttggcacaaag
ctcctgaaggtgccgttgatgctaggcttcctttacctctttgtctgctccctggacgtg
ctcagctctgccttccaactggccggagggaaagtggctggggacatcttcaaggacaat
gccatcctgtccaacccagtggcagggctggtggtgggaatcctggtgacagttctggtg
cagagctccagcacctcgacatccatcattgtcagcatggtctcctctggcttgttggag
gtgagctccgccattccgataatcatgggctccaacatcgggacctctgtcaccaacacc
attgtggccctgatgcaggcgggggacaggactgacttcaggcgggcttttgcaggggca
acagtgcatgactgctttaactggctgtctgttctggtcctgctgcccctggaggctgcc
acgggctacctgcaccacgtcaccgggcttgtggttgcctccttcaacatccgtggtggc
cgtgatgcccctgaccttctcaaggttatcacagagcccttcacaaagcttatcatccag
ctggacaagtctgtgattaccagcattgccgtgggggatgagtccctgaggaatcacagt
ctcattcggatttggtgtcaaccagagacaaaagaggcttccacttctatgtccagggta
gaggccattggcagccttgcaaacaccaccatggagaaatgcaaccatatcttcgtggat
actgggctgcccgacctggccgtggggctcattctgctggcgggctccctggtggtcctg
tgcacttgtcttatcctcctcgtcaagatgctcaactctctgctgaagggccaagtggcc
aatgtcatccagaaggtcatcaacacagacttcccagcccccttcacttgggtcacaggc
tactttgccatggtggtgggcgccagcatgacgtttgttgtccagagcagttccgtgttc
acctcagccatcactccgctcattggcctgggtgtgatcagtattgagcgggcctaccct
ctcaccctgggctccaacattggtaccaccactacagccatcctggcagcactggccagc
cccagggagaagctctccagctcctttcagattgccctctgccacttcttcttcaacatc
tcgggcatcctcctgtggtacccgctgccctgcacacgtctgcccatccgcatggccaag
gcactgggcaaacgcactgccaagtaccgctggtttgccgtcctctacctcctcgtgtgc
ttcctgctcctgccctcactggtgtttggcatttctatggcaggctggcaggctatggtc
ggtgtgggcacaccctttggggccctgctcgccttcgtggtgcttgttaacgtcctgcag
agtcgaagtcccgggcacctccccaagtggctgcagacatgggacttcctaccccgctgg
atgcactctctgcagcccctggatggccttatcacaagagccaccttgtgctatgccagg
cccgagccccgttcaccccaacttccccccagagtcttcctggaggagcttcctcctgcc
acgccctctccccgcctggcactgcccgctcaccacaatgccacccggctctag

DBGET integrated database retrieval system