KEGG   Rattus norvegicus (rat): 25551
Entry
25551             CDS       T01003                                 

Gene name
Slc2a3
Definition
(RefSeq) solute carrier family 2, facilitated glucose transporter member 3
  KO
K08142  MFS transporter, SP family, solute carrier family 2 (facilitated glucose transporter), member 3
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    25551 (Slc2a3)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC2: Facilitative GLUT transporter
   25551 (Slc2a3)
 Major facilitator superfamily (MFS)
  Sugar transporters
   Sugar porter (SP) family [TC:2.A.1.1]
    25551 (Slc2a3)
SSDB
Motif
Pfam: Sugar_tr MFS_1 Phage_holin_3_2 2-thiour_desulf
Other DBs
NCBI-GeneID: 25551
NCBI-ProteinID: NP_058798
RGD: 3706
Ensembl: ENSRNOG00000008376
UniProt: Q07647 A0A0G2JSJ3
Position
4
AA seq 493 aa
MGTAKVTPSLVFAVTVATIGSFQFGYNTGVINAPETIIKDFLNYTLEERLEDLPSEGLLT
TLWSLCVAIFSVGGMIGSFSVGLFVNRFGRRNSMLLVNLIAILGGCLMGFAKIAESVEML
ILGRLIIGIFCGLCTGFVPMYIGEVSPTALRGAFGTLNQLGIVVGILVAQVFGLDFILGS
EELWPGLLGLTIIPAILQSAALPFCPESPRFLLINRKEEDQATEILQRLWGTPDVIQEIQ
EMKDESIRMSQEKQVTVLELFKSPSYFQPLLISVVLQLSQQFSGINAVFYYSTGIFQDAG
VQEPIYATIGAGVVNTIFTVVSLFLVERAGRRTLHMIGLGGMAVCSVFMTISLLLKDEYE
AMSFVCIVAILVYVAFFEIGPGPIPWFIVAELFSQGPRPAAMAVAGCSNWTSNFLVGMFF
PSAAAYLGAYVFIIFAAFLVFFLIFTFFKVPETKGRTFEDITRAFEGQAQSGKGSAGVEL
NSMQPVKETPGNA
NT seq 1482 nt   +upstreamnt  +downstreamnt
atggggacagcgaaggtgaccccatctctggtgttcgctgttactgttgccacaatcggt
tctttccagtttggctacaacaccggagtcatcaatgcgcctgagacaatcattaaggac
tttcttaactacacgttggaagagcggttggaagacctaccaagcgaggggctgctgacc
acgctctggtcgttatgtgtggccatcttctccgttgggggcatgattggctctttttct
gtcggactctttgtcaaccgctttggcagacgcaactccatgcttctagtcaacctgatt
gccatccttgggggttgccttatgggcttcgccaagatagcggagtcggttgaaatgctg
atcctgggccgcctgattattggcatcttctgtggtctgtgcacgggctttgtgccgatg
tacattggagaggtgtctcccactgccctacggggtgcatttggcacgctaaaccagctg
ggcatcgttgttgggatccttgtggctcaggtctttggtttggactttattctgggctct
gaggagctgtggcctggactactgggcttaaccatcattccagctatcctacagagcgca
gcccttccgttttgccccgagagtccaaggttcttgctcattaacagaaaggaggaagac
caagcgacggagatcctccagcggttgtggggcaccccggatgtgatccaggagatccag
gagatgaaagacgagagtatcaggatgtcacaggagaagcaggtcactgtgctggagctc
ttcaagtctcctagctacttccagccccttctcatctccgttgtcctccagttgtctcag
cagttctctgggatcaatgctgtgttctattactcgacgggaatcttccaggatgcgggt
gtccaggagcccatctatgccacgattggagcgggtgtggtcaacactatcttcactgta
gtctctctgttcctggtggagcgggcaggaaggagaaccctgcacatgataggcctggga
ggcatggctgtttgctccgttttcatgacgatttctctgttactgaaggatgaatatgaa
gccatgagctttgtctgtattgtggctatcttggtctacgtggccttctttgagattggc
cctggccccattccctggtttattgtggctgaactcttcagccagggcccccgaccagct
gccatggctgtggctggctgttctaactggacctccaactttttggtgggaatgttcttc
ccctcggctgcggcctacttgggagcctacgtttttatcatcttcgctgccttcctcgtt
ttcttcctaatcttcaccttcttcaaagtcccagagaccaaaggcaggactttcgaggat
attacccgggccttcgaggggcaggcgcagtctgggaaaggctctgctggtgtggagttg
aacagcatgcagcctgtcaaggagacccctggcaatgcctga

DBGET integrated database retrieval system