KEGG   Rattus norvegicus (rat): 25553Help
Entry
25553             CDS       T01003                                 

Gene name
Slc6a4, SERT
Definition
(RefSeq) solute carrier family 6 member 4
  KO
K05037  solute carrier family 6 (neurotransmitter transporter, serotonin) member 4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04721  Synaptic vesicle cycle
rno04726  Serotonergic synapse
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    25553 (Slc6a4)
   04721 Synaptic vesicle cycle
    25553 (Slc6a4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    25553 (Slc6a4)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC6: Sodium- and chloride-dependent neurotransmitter transporter
   25553 (Slc6a4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SNF 5HT_transport_N UPF0114
Motif
Other DBs
NCBI-GeneID: 25553
NCBI-ProteinID: NP_037166
RGD: 3714
Ensembl: ENSRNOG00000003476
UniProt: P31652
Position
10q24
AA seq 630 aa AA seqDB search
METTPLNSQKVLSECKDREDCQENGVLQKGVPTTADRAEPSQISNGYSAVPSTSAGDEAS
HSIPAATTTLVAEIRQGERETWGKKMDFLLSVIGYAVDLGNIWRFPYICYQNGGGAFLLP
YTIMAIFGGIPLFYMELALGQYHRNGCISIWRKICPIFKGIGYAICIIAFYIASYYNTII
AWALYYLISSLTDRLPWTSCTNSWNTGNCTNYFAQDNITWTLHSTSPAEEFYLRHVLQIH
QSKGLQDLGTISWQLTLCIVLIFTVIYFSIWKGVKTSGKVVWVTATFPYIVLSVLLVRGA
TLPGAWRGVVFYLKPNWQKLLETGVWVDAAAQIFFSLGPGFGVLLAFASYNKFNNNCYQD
ALVTSVVNCMTSFVSGFVIFTVLGYMAEMRNEDVSEVAKDAGPSLLFITYAEAIANMPAS
TFFAIIFFLMLITLGLDSTFAGLEGVITAVLDEFPHIWAKRREWFVLIVVITCVLGSLLT
LTSGGAYVVTLLEEYATGPAVLTVALIEAVAVSWFYGITQFCSDVKEMLGFSPGWFWRIC
WVAISPLFLLFIICSFLMSPPQLRLFQYNYPHWSIVLGYCIGMSSVICIPTYIIYRLIST
PGTLKERIIKSITPETPTEIPCGDIRMNAV
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
atggagaccacacccttgaattctcagaaagtgctgtcagagtgtaaggacagagaggac
tgtcaagaaaatggtgttctacagaagggtgtccccaccacagcggacagggcagagcct
agccaaatatccaatgggtactctgcagtccccagcacaagtgcaggggacgaagcttca
cactcgatcccagctgccaccaccaccctggtggctgagattcgccaaggggagcgggag
acctggggcaagaagatggatttcctcctgtccgtcattggctatgccgtggacctgggc
aacatctggcggtttccttacatatgctaccagaatggcggaggggccttcctcctccct
tataccatcatggccattttcggggggatcccgctcttttacatggagctcgcactgggc
cagtaccaccgaaacgggtgcatttccatatggaggaagatctgcccgattttcaaaggc
attggttacgccatctgcatcatcgccttttacatcgcctcctactacaacaccatcata
gcctgggcgctctactacctcatctcctccctcacggaccggctgccctggactagctgc
acgaactcctggaacactggcaactgcaccaactacttcgcccaggacaacatcacctgg
acgctgcattccacgtcccccgctgaggagttctacttgcgccatgtcctgcagatccac
cagtctaagggactccaggacctgggcaccatcagctggcagctgactctctgcatcgtg
ctcatcttcaccgtaatctactttagcatctggaaaggcgtcaaaacatctggcaaggtg
gtgtgggtgacagccaccttcccatacattgtcctctctgtcctgctggtgaggggggcc
acccttcctggagcctggagaggggtcgtcttctacttgaaacccaactggcagaaactc
ttggagacaggggtgtgggtagatgccgccgctcagatcttcttctctcttggcccgggc
tttggggttctcctggcttttgctagctacaacaagttcaacaacaactgttaccaagat
gccctggtgaccagtgtggtgaactgcatgacaagcttcgtctctggcttcgtcatcttc
acggtgcttggctacatggcggagatgaggaatgaagatgtgtcagaggtggccaaagac
gcaggccccagcctcctcttcatcacgtatgcagaggcaatagccaacatgccagcatcc
acgttctttgccatcatcttcttcctcatgttaatcacgctgggattggacagcacgttc
gcaggcctggaaggtgtgatcacagctgtgctggatgagttccctcacatctgggccaag
cgcagggaatggttcgtgctcatcgtggtcatcacgtgcgtcttgggatccctgctcaca
ctgacgtcaggaggggcatacgtggtgactctgctggaggagtatgccacggggccagca
gtgctcaccgtggccctcatcgaggccgtcgccgtgtcttggttctatggaatcactcag
ttctgcagcgatgtgaaggagatgctgggcttcagcccgggatggttttggaggatctgc
tgggtggccatcagccctctgtttctcctgttcatcatttgcagttttctgatgagccca
ccccagctacggcttttccaatacaactatccccactggagtatcgtcttgggctactgc
atagggatgtcgtccgtcatctgcatccctacctatatcatttatcggctgatcagcact
ccggggacacttaaggagcgcattattaaaagtatcactcctgaaacacccacagaaatc
ccgtgtggggacatccgcatgaatgctgtgtaa

DBGET integrated database retrieval system