KEGG   Rattus norvegicus (rat): 25555Help
Entry
25555             CDS       T01003                                 

Gene name
Sstr4, Smstr4
Definition
(RefSeq) somatostatin receptor 4
  KO
K04220  somatostatin receptor 4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    25555 (Sstr4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    25555 (Sstr4)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Peptide
   Somatostatin
    25555 (Sstr4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7TM_GPCR_Srv 7tm_4 7TM_GPCR_Srw
Motif
Other DBs
NCBI-GeneID: 25555
NCBI-ProteinID: NP_037168
RGD: 3764
Ensembl: ENSRNOG00000004641
UniProt: P30937
Position
3q41
AA seq 384 aa AA seqDB search
MNTPATLPLGGEDTTWTPGINASWAPDEEEDAVRSDGTGTAGMVTIQCIYALVCLVGLVG
NALVIFVILRYAKMKTATNIYLLNLAVADELFMLSVPFVASAAALRHWPFGAVLCRAVLS
VDGLNMFTSVFCLTVLSVDRYVAVVHPLRAATYRRPSVAKLINLGVWLASLLVTLPIAVF
ADTRPARGGEAVACNLHWPHPAWSAVFVIYTFLLGFLLPVLAIGLCYLLIVGKMRAVALR
AGWQQRRRSEKKITRLVLMVVTVFVLCWMPFYVVQLLNLFVTSLDATVNHVSLILSYANS
CANPILYGFLSDNFRRSFQRVLCLRCCLLETTGGAEEEPLDYYATALKSRGGPGCICPPL
PCQQEPMQAEPACKRVPFTKTTTF
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgaacacgcctgcaactctgcccctggggggcgaggacaccacctggacccctgggatc
aacgccagctgggctccggatgaggaggaggatgcagtgcggtccgacggcacggggaca
gcgggcatggtaactatccagtgcatctatgcgctcgtgtgtctggtgggcctggtagga
aacgccctggtcatattcgtgatcctacgctatgccaaaatgaagacagccaccaacatc
tacctgctcaacctggccgtcgctgatgagctcttcatgctcagtgtgccatttgtggcc
tcggcggctgccctgcgccactggccgttcggggcggtgctgtgccgcgcagtgcttagt
gtggacggccttaacatgttcacgagtgtcttctgcctcacagtgctcagcgtggatcgc
tatgtggctgtagtgcaccctctgcgagctgccacctaccggcggcccagcgtggccaag
ctaatcaacctgggagtgtggctagcatccttgctggtcaccctgcccatcgcagtcttc
gctgacactaggccagctcgtgggggtgaggcagtagcttgcaacctgcactggcctcac
ccggcctggtctgcagtctttgtgatctatacttttttgctgggcttcctactcccggtt
ctggctatcggattatgttacctgcttatcgtgggcaagatgcgtgctgtggccctgcgg
gctggctggcaacaacggaggcgctcagagaagaagatcactaggctcgtgctaatggtg
gtgactgtctttgtgctatgctggatgccattctatgtagtgcagcttctgaatctgttt
gtcaccagcctcgatgccactgtcaaccatgtgtccctcatcctcagctatgccaacagc
tgtgccaacccgattctctatggtttcctctcagacaacttccgacgctctttccagcgg
gttctgtgcctgcgctgctgtctcctggaaacaactggaggtgctgaggaagagcccctg
gactactatgctactgctctcaaaagcagaggtggcccaggatgcatatgccctccattg
ccctgccagcaggagcccatgcaagcagaacctgcctgcaagcgagtccctttcaccaag
accactactttctga

DBGET integrated database retrieval system