KEGG   Rattus norvegicus (rat): 25556Help
Entry
25556             CDS       T01003                                 

Gene name
Il1rl1, FIT1, Fit-1, St2
Definition
(RefSeq) interleukin 1 receptor-like 1
  KO
K05171  interleukin 1 receptor-like 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    25556 (Il1rl1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:rno04050]
    25556 (Il1rl1)
Cytokine receptors [BR:rno04050]
 Interleukin receptor families
  IL1 receptor family
   25556 (Il1rl1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TIR Ig_3 ig Ig_2 I-set Ig_6 V-set TIR_2 Tudor-knot
Motif
Other DBs
NCBI-GeneID: 25556
NCBI-ProteinID: NP_001121161
RGD: 2894
Ensembl: ENSRNOG00000014835
UniProt: Q62611
Position
9q22
AA seq 566 aa AA seqDB search
MIGKWRMGLWALAILTVPMYFIVTEGRKTSWGLENEALIVRCPQRGGAINPVEWYYSNTN
ERIPTQKRNRIFVSRDRLKFLPAKVEDSGIYTCVIRSPESIKTGSLNVTIYKRPPNCKIP
DYMMYSTVDGSDKNSKITCPTIALYNWTAPVQWFKNCKALQGPRFRAHMSYLFIDKVSHV
DEGDYTCRFTHTENGTNYIVTATRSFTVEEKGFSTFPVITNPPHNYTVEVEIGKTANIAC
SACFGTASQFVAVLWQINKTRIGSFGKARIQEEKGPNKSSSNGMICLTSLLRITGVTDKD
FSLKYDCVAMNHHGVIRHPVRLRRKQPIDHQSTYYIVAGCSLLLMFINVLVIVLKVFWIE
VALFWRDIMAPYKTQNDGKLYDAYIIYPRVFRGSAAGTGSVEYFVHYTLPDVLENKCGYK
LCIYGRDLLPGQDAATVVESSIQNSRRQVFVLAPHMMHSKEFAYEQEIALHSALIQNNSK
VILIEMEPMGEASRLQLGDLQDSLQHLVKMQGTIKWREDHVADKQSLSSKFWKHVRYQMP
VPKRPPKMASVAAPLSGKVCLDLKHF
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atgattggcaaatggagaatggggctttgggctttggcaattctgacagttcccatgtat
ttcatagtgacagagggcagaaaaacatcctggggtctagaaaacgaggctttaattgtc
agatgcccccaaagaggaggtgcgattaaccctgtggaatggtattattcaaatacaaat
gaaagaattcctactcaaaagagaaatcggatcttcgtctcaagagatcgtctgaagttt
ctaccagccaaagtggaagactctgggatttatacgtgtgttatcagaagccctgaatcg
attaagaccggatctttgaatgtcaccatatataaaagaccaccaaactgcaaaatccct
gattacatgatgtactcgacagtagatggatcagataaaaattccaagataacatgtcca
acaattgccttgtataattggacagcgcctgttcagtggtttaagaactgcaaagctctc
caagggccaaggttcagggcacacatgtcctatttgttcattgacaaagtgagtcatgtt
gatgaaggtgactacacatgtcgattcactcacacggagaacggaaccaattacattgtg
actgccaccagatcattcacagttgaagaaaaaggcttctctacatttccagtaattaca
aaccctccacacaactacacagtggaagtggaaataggaaaaacagcaaacattgcctgc
tcagcttgctttggcacagcctctcagttcgttgctgtcctgtggcagattaacaaaacg
agaattggatcttttggcaaagcaagaattcaagaagagaaaggcccaaataaaagttcc
agcaatggcatgatttgcttaacctcactgttaaggataactggtgtgaccgacaaggac
ttctccctgaaatatgactgtgtggccatgaaccatcacggagtgataaggcaccccgta
agactgagaaggaaacaaccaattgaccaccaaagcacctactacatagttgccggatgt
agtttattgctaatgtttatcaatgtcttggtgatagtcttaaaagtgttctggattgag
gttgctctgttctggagagatataatggcaccttacaaaacccagaatgatggaaagctc
tatgatgcttacatcatttaccctcgggtcttccggggcagcgcagcagggaccggctct
gtggagtactttgttcactacactctgcccgacgttctcgaaaataaatgtggctacaag
ttgtgcatttacgggagagacctgctgcctgggcaagatgcggccactgtggtggaaagc
agtatccagaatagtagacggcaagtgtttgtcctggcccctcacatgatgcacagcaaa
gagtttgcctatgagcaggagatcgccctgcacagcgccctcatccagaacaactccaag
gtgattctgattgaaatggagcctatgggtgaggcaagccgactgcagcttggggatctg
caagattctctccagcatcttgtgaaaatgcaggggaccatcaagtggagggaagaccac
gtggccgacaaacagtctctaagctccaaattctggaagcatgtgagataccaaatgcca
gtcccgaaaagaccccccaagatggcatctgttgccgctccgttgagtggcaaggtgtgc
ttggacctgaaacacttttga

DBGET integrated database retrieval system